UniProt ID | HPRT_MOUSE | |
---|---|---|
UniProt AC | P00493 | |
Protein Name | Hypoxanthine-guanine phosphoribosyltransferase | |
Gene Name | Hprt1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 218 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway (By similarity).. | |
Protein Sequence | MPTRSPSVVISDDEPGYDLDLFCIPNHYAEDLEKVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKQYSPKMVKVASLLVKRTSRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MPTRSPSVVI -----CCCCCCCEEE | 42.34 | 26745281 | |
5 | Phosphorylation | ---MPTRSPSVVISD ---CCCCCCCEEECC | 24.81 | 26745281 | |
7 | Phosphorylation | -MPTRSPSVVISDDE -CCCCCCCEEECCCC | 30.20 | 26745281 | |
11 | Phosphorylation | RSPSVVISDDEPGYD CCCCEEECCCCCCCC | 27.65 | 21189417 | |
23 | Glutathionylation | GYDLDLFCIPNHYAE CCCCEEEEECCHHHH | 7.03 | 24333276 | |
83 | Acetylation | ADLLDYIKALNRNSD HHHHHHHHHHCCCCC | 40.36 | 23954790 | |
83 | Ubiquitination | ADLLDYIKALNRNSD HHHHHHHHHHCCCCC | 40.36 | - | |
103 | Malonylation | TVDFIRLKSYCNDQS EEEEEEEHHHHCCCC | 29.54 | 26320211 | |
103 | Ubiquitination | TVDFIRLKSYCNDQS EEEEEEEHHHHCCCC | 29.54 | - | |
103 | Acetylation | TVDFIRLKSYCNDQS EEEEEEEHHHHCCCC | 29.54 | 23806337 | |
104 | Phosphorylation | VDFIRLKSYCNDQST EEEEEEHHHHCCCCC | 39.24 | 30635358 | |
106 | S-nitrosylation | FIRLKSYCNDQSTGD EEEEHHHHCCCCCCC | 6.13 | 22178444 | |
106 | Glutathionylation | FIRLKSYCNDQSTGD EEEEHHHHCCCCCCC | 6.13 | 24333276 | |
106 | S-nitrosocysteine | FIRLKSYCNDQSTGD EEEEHHHHCCCCCCC | 6.13 | - | |
110 | Phosphorylation | KSYCNDQSTGDIKVI HHHHCCCCCCCEEEE | 36.90 | 25521595 | |
111 | Phosphorylation | SYCNDQSTGDIKVIG HHHCCCCCCCEEEEC | 32.99 | 23984901 | |
115 | Ubiquitination | DQSTGDIKVIGGDDL CCCCCCEEEECCCCH | 32.32 | - | |
115 | Malonylation | DQSTGDIKVIGGDDL CCCCCCEEEECCCCH | 32.32 | 26320211 | |
115 | Acetylation | DQSTGDIKVIGGDDL CCCCCCEEEECCCCH | 32.32 | 23236377 | |
128 | Ubiquitination | DLSTLTGKNVLIVED CHHHHCCCCEEEEEE | 38.35 | - | |
139 | Phosphorylation | IVEDIIDTGKTMQTL EEEEEHHCCHHHHHH | 30.12 | 29899451 | |
142 | Phosphorylation | DIIDTGKTMQTLLSL EEHHCCHHHHHHHHH | 18.82 | 27180971 | |
145 | Phosphorylation | DTGKTMQTLLSLVKQ HCCHHHHHHHHHHHH | 20.88 | 29472430 | |
148 | Phosphorylation | KTMQTLLSLVKQYSP HHHHHHHHHHHHHCH | 33.94 | 27180971 | |
151 | Acetylation | QTLLSLVKQYSPKMV HHHHHHHHHHCHHHH | 49.14 | 22826441 | |
151 | Ubiquitination | QTLLSLVKQYSPKMV HHHHHHHHHHCHHHH | 49.14 | 27667366 | |
153 | Phosphorylation | LLSLVKQYSPKMVKV HHHHHHHHCHHHHHH | 22.63 | 28059163 | |
156 | Ubiquitination | LVKQYSPKMVKVASL HHHHHCHHHHHHHHH | 50.84 | - | |
159 | Ubiquitination | QYSPKMVKVASLLVK HHCHHHHHHHHHHHH | 28.69 | - | |
166 | Acetylation | KVASLLVKRTSRSVG HHHHHHHHHHCCCCC | 50.34 | 22826441 | |
166 | Ubiquitination | KVASLLVKRTSRSVG HHHHHHHHHHCCCCC | 50.34 | 27667366 | |
206 | Glutathionylation | FRDLNHVCVISETGK HHCCCCEEEEECCCC | 1.42 | 24333276 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HPRT_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HPRT_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HPRT_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HPRT_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...