dbPTM

HPM1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HPM1_SCHPO
UniProt AC	Q9UTQ8
Protein Name	Histidine protein methyltransferase 1
Gene Name	SPAC1071.05
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	339
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Required for histidine methylation of RPL3 at 'His-243'..
Protein Sequence	MQANGFSFGFYDEPNNLNGQDVGADSLPSVAIESDSLGHMLKYIPEKLSYARVSGLGHTFVQRELWDVKMQLMEQDDSIESDDKLKVLDGCNDLVPNVYEGGYKTWECSLDLANEIKKIDVVKNNLTTVLELGCGSAIPILSCFQEFYKHRIPCTLVFQDFNVDVLRYVTLPNLLLNWYFCTQEHDSSEKHGTIDVSPSLLQEFSDDLARTNIYCEFLCGCWSEEMQLLIQRTYGDHYFSLVLASETIYSLPSLENFLYMLLKNTKNLALVAGKDLYFGVGGSILEFNSRLQKLVDDPNSLKAIKTSTQNVGRSIVYWEKEFPPSNIDSSPQSPLPGSL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
78	Phosphorylation	QLMEQDDSIESDDKL HHHHCCCCCCCCCHH	36.22	21712547
325	Phosphorylation	WEKEFPPSNIDSSPQ EECCCCCCCCCCCCC	46.81	21712547
329	Phosphorylation	FPPSNIDSSPQSPLP CCCCCCCCCCCCCCC	39.87	21712547
330	Phosphorylation	PPSNIDSSPQSPLPG CCCCCCCCCCCCCCC	24.18	24763107
333	Phosphorylation	NIDSSPQSPLPGSL- CCCCCCCCCCCCCC-	31.61	28889911
338	Phosphorylation	PQSPLPGSL------ CCCCCCCCC------	29.03	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HPM1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HPM1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HPM1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of HPM1_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HPM1_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-333 AND SER-338, ANDMASS SPECTROMETRY.	18257517 [Abstract]