| UniProt ID | HPCL1_RAT | |
|---|---|---|
| UniProt AC | P62749 | |
| Protein Name | Hippocalcin-like protein 1 | |
| Gene Name | Hpcal1 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 193 | |
| Subcellular Localization |
Membrane Lipid-anchor . |
|
| Protein Description | May be involved in the calcium-dependent regulation of rhodopsin phosphorylation.. | |
| Protein Sequence | MGKQNSKLRPEVLQDLREHTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIKGAKSDPSIVRLLQCDPSSASQF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Myristoylation | ------MGKQNSKLR ------CCCCCCCCC | 40.01 | - | |
| 50 | Ubiquitination | LTVDEFKKIYANFFP CCHHHHHHHHHHCCC | 46.39 | - | |
| 52 | Phosphorylation | VDEFKKIYANFFPYG HHHHHHHHHHCCCCC | 12.36 | - | |
| 58 | Phosphorylation | IYANFFPYGDASKFA HHHHCCCCCCHHHHH | 23.60 | - | |
| 63 | Ubiquitination | FPYGDASKFAEHVFR CCCCCHHHHHHHHHH | 50.76 | - | |
| 137 | Ubiquitination | KMVSSVMKMPEDEST HHHHHHHCCCCCCCC | 49.50 | - | |
| 147 | Ubiquitination | EDESTPEKRTDKIFR CCCCCCCHHHHHHHH | 62.90 | - | |
| 163 | Acetylation | MDTNNDGKLSLEEFI CCCCCCCCCCHHHHH | 37.45 | 22902405 | |
| 174 | Ubiquitination | EEFIKGAKSDPSIVR HHHHHHCCCCHHHHH | 65.15 | - | |
| 175 | Phosphorylation | EFIKGAKSDPSIVRL HHHHHCCCCHHHHHH | 54.97 | 30181290 | |
| 189 | Phosphorylation | LLQCDPSSASQF--- HEECCCCCCCCC--- | 37.01 | - | |
| 191 | Phosphorylation | QCDPSSASQF----- ECCCCCCCCC----- | 33.78 | 23984901 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HPCL1_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HPCL1_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HPCL1_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HPCL1_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
