| UniProt ID | HPBP1_MOUSE | |
|---|---|---|
| UniProt AC | Q99P31 | |
| Protein Name | Hsp70-binding protein 1 | |
| Gene Name | Hspbp1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 357 | |
| Subcellular Localization | ||
| Protein Description | Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of target proteins (By similarity).. | |
| Protein Sequence | MADKGSGGSRLPLALPPASQGCSSGGSGSSAGGSGNPRPPRNLQGLLQMAITAGSQEPDPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKNCLRVLSQATPAMAGEAELATDQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDSCDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQREEYQEELEFCEKLLQTCFSSPTDDSMDR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 22 | Glutathionylation | LPPASQGCSSGGSGS CCCHHHCCCCCCCCC | 1.96 | 24333276 | |
| 102 | Phosphorylation | LRVLSQATPAMAGEA HHHHHHCCHHHHCCH | 12.16 | 25338131 | |
| 199 | Glutathionylation | RLLDRDSCDTVRVKA HHHCCCCCCHHHHHH | 6.27 | 24333276 | |
| 201 | Phosphorylation | LDRDSCDTVRVKALF HCCCCCCHHHHHHHH | 17.97 | - | |
| 231 | Phosphorylation | FLRLDGFSVLMRAMQ HHHCCHHHHHHHHHH | 21.63 | 28066266 | |
| 243 | Ubiquitination | AMQQQVQKLKVKSAF HHHHHHHHHHHHHHH | 51.96 | 22790023 | |
| 345 | Phosphorylation | FCEKLLQTCFSSPTD HHHHHHHHHHCCCCC | 18.58 | 25619855 | |
| 348 | Phosphorylation | KLLQTCFSSPTDDSM HHHHHHHCCCCCCCC | 37.24 | 24925903 | |
| 349 | Phosphorylation | LLQTCFSSPTDDSMD HHHHHHCCCCCCCCC | 16.15 | 25521595 | |
| 351 | Phosphorylation | QTCFSSPTDDSMDR- HHHHCCCCCCCCCC- | 55.15 | 24925903 | |
| 354 | Phosphorylation | FSSPTDDSMDR---- HCCCCCCCCCC---- | 25.95 | 25619855 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HPBP1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HPBP1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HPBP1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HPBP1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
