HOP_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HOP_MOUSE
• UniProt AC: Q8R1H0
• Protein Name: Homeodomain-only protein
• Gene Name: Hopx
• Organism: Mus musculus (Mouse).
• Sequence Length: 73
• Subcellular Localization: Nucleus . Cytoplasm . According to PubMed:14516659 it is cytoplasmic.
• Protein Description: Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy. [PubMed: 12297045]
• Protein Sequence: MSAQTASGPTEDQVEILEYNFNKVNKHPDPTTLCLIAAEAGLTEEQTQKWFKQRLAEWRRSEGLPSECRSVTD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MSAQTASGPTED ---CCCCCCCCCCHH	23.62	24719451
34	S-nitrosocysteine	HPDPTTLCLIAAEAG CCCHHHHHHHHHHHC	2.13	-
34	S-nitrosylation	HPDPTTLCLIAAEAG CCCHHHHHHHHHHHC	2.13	21278135
61	Phosphorylation	RLAEWRRSEGLPSEC HHHHHHHHCCCCHHH	27.69	23527152
66	Phosphorylation	RRSEGLPSECRSVTD HHHCCCCHHHCCCCC	55.13	27742792
68	S-nitrosocysteine	SEGLPSECRSVTD-- HCCCCHHHCCCCC--	4.63	-
68	S-nitrosylation	SEGLPSECRSVTD-- HCCCCHHHCCCCC--	4.63	21278135
70	Phosphorylation	GLPSECRSVTD---- CCCHHHCCCCC----	40.82	25266776
72	Phosphorylation	PSECRSVTD------ CHHHCCCCC------	36.92	27742792

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HOP_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HOP_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HOP_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EPC1_HUMAN	EPC1	physical	17192267

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.