UniProt ID | HNMT_HUMAN | |
---|---|---|
UniProt AC | P50135 | |
Protein Name | Histamine N-methyltransferase | |
Gene Name | HNMT | |
Organism | Homo sapiens (Human). | |
Sequence Length | 292 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Inactivates histamine by N-methylation. Plays an important role in degrading histamine and in regulating the airway response to histamine.. | |
Protein Sequence | MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | SSMRSLFSDHGKYVE CHHHHHHCCCCHHHH | 33.71 | 22985185 | |
52 | Phosphorylation | GRIGDTKSEIKILSI CCCCCCCCEEEEEEE | 46.80 | 22798277 | |
72 | Phosphorylation | EIDLQILSKVQAQYP HHHHHHHHHHHHCCC | 32.20 | 24719451 | |
78 (in isoform 2) | Phosphorylation | - | 12.64 | - | |
84 (in isoform 2) | Phosphorylation | - | 33.22 | - | |
99 | Ubiquitination | AEQIAKYKELVAKTS HHHHHHHHHHHHHHC | 43.81 | - | |
104 | Ubiquitination | KYKELVAKTSNLENV HHHHHHHHHCCCCCE | 45.03 | - | |
112 | Acetylation | TSNLENVKFAWHKET HCCCCCEEEEEECCC | 40.73 | 23236377 | |
114 (in isoform 2) | Phosphorylation | - | 11.18 | 15302935 | |
119 | Phosphorylation | KFAWHKETSSEYQSR EEEEECCCCHHHHHH | 42.21 | 22210691 | |
120 | Phosphorylation | FAWHKETSSEYQSRM EEEECCCCHHHHHHH | 23.43 | 22210691 | |
121 | Phosphorylation | AWHKETSSEYQSRML EEECCCCHHHHHHHH | 47.98 | 22210691 | |
130 | Ubiquitination | YQSRMLEKKELQKWD HHHHHHHHHHHHHHH | 47.81 | - | |
131 | Ubiquitination | QSRMLEKKELQKWDF HHHHHHHHHHHHHHH | 55.04 | - | |
160 | Phosphorylation | ATLKFFHSLLGTNAK HHHHHHHHHHCCCCE | 21.82 | 23312004 | |
164 | Phosphorylation | FFHSLLGTNAKMLII HHHHHHCCCCEEEEE | 31.79 | 23312004 | |
174 | Phosphorylation | KMLIIVVSGSSGWDK EEEEEEEECCCHHHH | 23.28 | - | |
176 | Phosphorylation | LIIVVSGSSGWDKLW EEEEEECCCHHHHHH | 20.40 | - | |
177 | Phosphorylation | IIVVSGSSGWDKLWK EEEEECCCHHHHHHH | 47.64 | - | |
284 | Phosphorylation | GKVLFNNTLSFIVIE CEEEECCEEEEEEEE | 25.53 | 23186163 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HNMT_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HNMT_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HNMT_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HNMT_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...