HNL_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HNL_ARATH
• UniProt AC: Q9LFT6
• Protein Name: Alpha-hydroxynitrile lyase
• Gene Name: HNL
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 258
• Protein Description: Involved in cyanogenesis, the release of HCN from injured tissues (By similarity). Displays R-selective hydroxynitrile lyase activity. Also accepts nitromethane (MeNO2) as a donor in a reaction with aromatic aldehydes to yield (R)-beta-nitro alcohols..
• Protein Sequence: MERKHHFVLVHNAYHGAWIWYKLKPLLESAGHRVTAVELAASGIDPRPIQAVETVDEYSKPLIETLKSLPENEEVILVGFSFGGINIALAADIFPAKIKVLVFLNAFLPDTTHVPSHVLDKYMEMPGGLGDCEFSSHETRNGTMSLLKMGPKFMKARLYQNCPIEDYELAKMLHRQGSFFTEDLSKKEKFSEEGYGSVQRVYVMSSEDKAIPCDFIRWMIDNFNVSKVYEIDGGDHMVMLSKPQKLFDSLSAIATDYM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
178	Phosphorylation	KMLHRQGSFFTEDLS HHHHHCCCCCCCCCC	14.62	30407730
181	Phosphorylation	HRQGSFFTEDLSKKE HHCCCCCCCCCCHHH	26.95	30407730
185	Phosphorylation	SFFTEDLSKKEKFSE CCCCCCCCHHHCCCC	54.74	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HNL_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HNL_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HNL_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of HNL_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.