HMRA2_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HMRA2_YEAST
• UniProt AC: P0CY13
• Protein Name: Silenced mating-type protein A2
• Gene Name: HMRA2
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 119
• Subcellular Localization: Nucleus .
• Protein Description: Probably not a functional protein. Cells lacking A2 show no obvious alterations in mating, sporulation and cell growth (By similarity)..
• Protein Sequence: MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
18	Ubiquitination	YQLTQKNKSADGLVF CCCCCCCCCCCCCEE	54.80	17644757
35	Ubiquitination	VTQDMINKSTKPYRG EEHHHHCCCCCCCCC	48.88	17644757
97	Ubiquitination	SNRRRKEKTITIAPE HCCCCCCCEEEECHH	48.54	17644757
116	Ubiquitination	LSGEPLAKKKE---- HCCCCCCCCCC----	72.55	17644757
117	Ubiquitination	SGEPLAKKKE----- CCCCCCCCCC-----	57.43	17644757

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HMRA2_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HMRA2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HMRA2_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of HMRA2_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.