| UniProt ID | HMRA2_YEAST | |
|---|---|---|
| UniProt AC | P0CY13 | |
| Protein Name | Silenced mating-type protein A2 | |
| Gene Name | HMRA2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 119 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Probably not a functional protein. Cells lacking A2 show no obvious alterations in mating, sporulation and cell growth (By similarity).. | |
| Protein Sequence | MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 18 | Ubiquitination | YQLTQKNKSADGLVF CCCCCCCCCCCCCEE | 54.80 | 17644757 | |
| 35 | Ubiquitination | VTQDMINKSTKPYRG EEHHHHCCCCCCCCC | 48.88 | 17644757 | |
| 97 | Ubiquitination | SNRRRKEKTITIAPE HCCCCCCCEEEECHH | 48.54 | 17644757 | |
| 116 | Ubiquitination | LSGEPLAKKKE---- HCCCCCCCCCC---- | 72.55 | 17644757 | |
| 117 | Ubiquitination | SGEPLAKKKE----- CCCCCCCCCC----- | 57.43 | 17644757 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HMRA2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HMRA2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HMRA2_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HMRA2_YEAST !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...