HMGB3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HMGB3_ARATH
• UniProt AC: P93047
• Protein Name: High mobility group B protein 3
• Gene Name: HMGB3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 141
• Subcellular Localization: Nucleus . Cytoplasm, cytosol .
• Protein Description: Binds preferentially double-stranded DNA..
• Protein Sequence: MKGAKSKAETRSTKLSVTKKPAKGAKGAAKDPNKPKRPSSAFFVFMEDFRVTYKEEHPKNKSVAAVGKAGGEKWKSLSDSEKAPYVAKADKRKVEYEKNMKAYNKKLEEGPKEDEESDKSVSEVNDEDDAEDGSEEEEDDD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
76	Phosphorylation	AGGEKWKSLSDSEKA CCCCHHCCCCHHCCC	31.80	23776212
78	Phosphorylation	GEKWKSLSDSEKAPY CCHHCCCCHHCCCCC	46.30	23776212
80	Phosphorylation	KWKSLSDSEKAPYVA HHCCCCHHCCCCCEE	37.31	23776212
117	Phosphorylation	GPKEDEESDKSVSEV CCCCCHHCCCCHHHC	48.57	23776212
120	Phosphorylation	EDEESDKSVSEVNDE CCHHCCCCHHHCCCC	35.55	23776212
122	Phosphorylation	EESDKSVSEVNDEDD HHCCCCHHHCCCCCC	42.81	23776212
134	Phosphorylation	EDDAEDGSEEEEDDD CCCCCCCCCCCCCCC	54.91	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HMGB3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HMGB3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HMGB3_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of HMGB3_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.