dbPTM

HMGB2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HMGB2_ARATH
UniProt AC	O49596
Protein Name	High mobility group B protein 2
Gene Name	HMGB2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	144
Subcellular Localization	Nucleus . Cytoplasm, cytosol .
Protein Description	Binds preferentially double-stranded DNA. Confers sensitivity to salt and drought stresses..
Protein Sequence	MKGAKSKTETRSSKLSVTKKPAKGAGRGKAAAKDPNKPKRPASAFFVFMEDFRETFKKENPKNKSVATVGKAAGDKWKSLSDSEKAPYVAKAEKRKVEYEKNIKAYNKKLEEGPKEDEESDKSVSEVNDEDDAEDGSEEEEDDD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Phosphorylation	ETRSSKLSVTKKPAK CCCCCCCCCCCCCCC	31.32	25561503
65	Phosphorylation	KENPKNKSVATVGKA HHCCCCCCCHHHHHH	26.78	26811356
79	Phosphorylation	AAGDKWKSLSDSEKA HCCCHHHCCCHHCCC	31.80	23776212
81	Phosphorylation	GDKWKSLSDSEKAPY CCHHHCCCHHCCCCC	46.30	23776212
83	Phosphorylation	KWKSLSDSEKAPYVA HHHCCCHHCCCCCHH	37.31	23776212
120	Phosphorylation	GPKEDEESDKSVSEV CCCCCHHCCCCHHHC	48.57	23776212
123	Phosphorylation	EDEESDKSVSEVNDE CCHHCCCCHHHCCCC	35.55	23776212
125	Phosphorylation	EESDKSVSEVNDEDD HHCCCCHHHCCCCCC	42.81	23776212
137	Phosphorylation	EDDAEDGSEEEEDDD CCCCCCCCCCCCCCC	54.91	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HMGB2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HMGB2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HMGB2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of HMGB2_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HMGB2_ARATH

Related Literatures of Post-Translational Modification