| UniProt ID | HMGB2_ARATH | |
|---|---|---|
| UniProt AC | O49596 | |
| Protein Name | High mobility group B protein 2 | |
| Gene Name | HMGB2 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 144 | |
| Subcellular Localization | Nucleus . Cytoplasm, cytosol . | |
| Protein Description | Binds preferentially double-stranded DNA. Confers sensitivity to salt and drought stresses.. | |
| Protein Sequence | MKGAKSKTETRSSKLSVTKKPAKGAGRGKAAAKDPNKPKRPASAFFVFMEDFRETFKKENPKNKSVATVGKAAGDKWKSLSDSEKAPYVAKAEKRKVEYEKNIKAYNKKLEEGPKEDEESDKSVSEVNDEDDAEDGSEEEEDDD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 16 | Phosphorylation | ETRSSKLSVTKKPAK CCCCCCCCCCCCCCC | 31.32 | 25561503 | |
| 65 | Phosphorylation | KENPKNKSVATVGKA HHCCCCCCCHHHHHH | 26.78 | 26811356 | |
| 79 | Phosphorylation | AAGDKWKSLSDSEKA HCCCHHHCCCHHCCC | 31.80 | 23776212 | |
| 81 | Phosphorylation | GDKWKSLSDSEKAPY CCHHHCCCHHCCCCC | 46.30 | 23776212 | |
| 83 | Phosphorylation | KWKSLSDSEKAPYVA HHHCCCHHCCCCCHH | 37.31 | 23776212 | |
| 120 | Phosphorylation | GPKEDEESDKSVSEV CCCCCHHCCCCHHHC | 48.57 | 23776212 | |
| 123 | Phosphorylation | EDEESDKSVSEVNDE CCHHCCCCHHHCCCC | 35.55 | 23776212 | |
| 125 | Phosphorylation | EESDKSVSEVNDEDD HHCCCCHHHCCCCCC | 42.81 | 23776212 | |
| 137 | Phosphorylation | EDDAEDGSEEEEDDD CCCCCCCCCCCCCCC | 54.91 | 30291188 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HMGB2_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HMGB2_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HMGB2_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HMGB2_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...