| UniProt ID | HMGA1_RAT | |
|---|---|---|
| UniProt AC | Q8K585 | |
| Protein Name | High mobility group protein HMG-I/HMG-Y | |
| Gene Name | Hmga1 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 107 | |
| Subcellular Localization | Nucleus. Chromosome. | |
| Protein Description | HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions (By similarity).. | |
| Protein Sequence | MSESVSKSSQPLASKQEKDGTEKRGRGRPRKQPSVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGTAKTRKVTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSESVSKSS ------CCCCCCCCC | 38.28 | 27097102 | |
| 2 | Acetylation | ------MSESVSKSS ------CCCCCCCCC | 38.28 | - | |
| 4 | Phosphorylation | ----MSESVSKSSQP ----CCCCCCCCCCC | 25.12 | 27097102 | |
| 6 | Phosphorylation | --MSESVSKSSQPLA --CCCCCCCCCCCCC | 35.78 | 23984901 | |
| 7 | Acetylation | -MSESVSKSSQPLAS -CCCCCCCCCCCCCC | 52.55 | 22902405 | |
| 8 | ADP-ribosylation | MSESVSKSSQPLASK CCCCCCCCCCCCCCH | 27.05 | - | |
| 8 | Phosphorylation | MSESVSKSSQPLASK CCCCCCCCCCCCCCH | 27.05 | 23984901 | |
| 9 | Phosphorylation | SESVSKSSQPLASKQ CCCCCCCCCCCCCHH | 39.28 | 23984901 | |
| 9 | ADP-ribosylation | SESVSKSSQPLASKQ CCCCCCCCCCCCCHH | 39.28 | - | |
| 15 | Acetylation | SSQPLASKQEKDGTE CCCCCCCHHCCCCCC | 57.79 | 25786129 | |
| 18 | Acetylation | PLASKQEKDGTEKRG CCCCHHCCCCCCCCC | 59.99 | 22902405 | |
| 26 | Methylation | DGTEKRGRGRPRKQP CCCCCCCCCCCCCCC | 41.82 | - | |
| 26 | Asymmetric dimethylarginine | DGTEKRGRGRPRKQP CCCCCCCCCCCCCCC | 41.82 | - | |
| 34 (in isoform 2) | Phosphorylation | - | 32.50 | 27097102 | |
| 34 | Phosphorylation | GRPRKQPSVSPGTAL CCCCCCCCCCCCCCC | 32.50 | 27097102 | |
| 35 (in isoform 2) | Acetylation | - | 11.58 | - | |
| 36 | Phosphorylation | PRKQPSVSPGTALVG CCCCCCCCCCCCCCC | 23.19 | 27097102 | |
| 38 (in isoform 2) | Phosphorylation | - | 19.00 | 23984901 | |
| 39 | Phosphorylation | QPSVSPGTALVGSQK CCCCCCCCCCCCCCC | 21.87 | 27097102 | |
| 42 (in isoform 2) | Phosphorylation | - | 6.86 | 28432305 | |
| 44 | Phosphorylation | PGTALVGSQKEPSEV CCCCCCCCCCCCCCC | 30.51 | 27097102 | |
| 49 | Phosphorylation | VGSQKEPSEVPTPKR CCCCCCCCCCCCCCC | 52.93 | 28432305 | |
| 53 | Phosphorylation | KEPSEVPTPKRPRGR CCCCCCCCCCCCCCC | 46.77 | 27097102 | |
| 58 | Methylation | VPTPKRPRGRPKGSK CCCCCCCCCCCCCCC | 58.76 | - | |
| 58 | Asymmetric dimethylarginine | VPTPKRPRGRPKGSK CCCCCCCCCCCCCCC | 58.76 | - | |
| 60 | Methylation | TPKRPRGRPKGSKNK CCCCCCCCCCCCCCC | 30.91 | - | |
| 60 | Asymmetric dimethylarginine | TPKRPRGRPKGSKNK CCCCCCCCCCCCCCC | 30.91 | - | |
| 64 | Phosphorylation | PRGRPKGSKNKGTAK CCCCCCCCCCCCCCC | 38.90 | 22817900 | |
| 78 | Phosphorylation | KTRKVTTTPGRKPRG CEEEEECCCCCCCCC | 17.87 | 22817900 | |
| 99 | Phosphorylation | KEEEEGISQESSEEE HHHHCCCCCCCHHHC | 38.46 | 23712012 | |
| 102 | Phosphorylation | EEGISQESSEEEQ-- HCCCCCCCHHHCC-- | 35.10 | 23712012 | |
| 103 | Phosphorylation | EGISQESSEEEQ--- CCCCCCCHHHCC--- | 48.55 | 23712012 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 36 | S | Phosphorylation | Kinase | CDC2 | P39951 | Uniprot |
| 36 | S | Phosphorylation | Kinase | HIPK2 | - | Uniprot |
| 44 | S | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
| 44 | S | Phosphorylation | Kinase | PRKCB | P05771 | GPS |
| 44 | S | Phosphorylation | Kinase | PRKCD | Q05655 | GPS |
| 44 | S | Phosphorylation | Kinase | PRKCG | P05129 | GPS |
| 53 | T | Phosphorylation | Kinase | CDK1 | P06493 | PSP |
| 53 | T | Phosphorylation | Kinase | CDC2 | P39951 | Uniprot |
| 53 | T | Phosphorylation | Kinase | HIPK2 | - | Uniprot |
| 64 | S | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
| 64 | S | Phosphorylation | Kinase | PRKCB | P05771 | GPS |
| 64 | S | Phosphorylation | Kinase | PRKCD | Q05655 | GPS |
| 64 | S | Phosphorylation | Kinase | PRKCG | P05129 | GPS |
| 78 | T | Phosphorylation | Kinase | CDK1 | P06493 | PSP |
| 78 | T | Phosphorylation | Kinase | CDC2 | P39951 | Uniprot |
| 78 | T | Phosphorylation | Kinase | HIPK2 | - | Uniprot |
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 58 | R | Methylation |
| - |
| 60 | R | Methylation |
| - |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HMGA1_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HMGA1_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative phosphoproteomics of vasopressin-sensitive renal cells:regulation of aquaporin-2 phosphorylation at two sites."; Hoffert J.D., Pisitkun T., Wang G., Shen R.-F., Knepper M.A.; Proc. Natl. Acad. Sci. U.S.A. 103:7159-7164(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-103, AND MASSSPECTROMETRY. | |