UniProt ID | HM32_CAEEL | |
---|---|---|
UniProt AC | Q23175 | |
Protein Name | Homeobox protein ceh-32 | |
Gene Name | ceh-32 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 439 | |
Subcellular Localization | Nucleus. | |
Protein Description | Plays a role in head morphogenesis, expression is regulated by vab-3.. | |
Protein Sequence | MFTPEQFTKVMSQLGNFSQLGQMFQPGNVAMLQALQANGASSTPSLFPAMPSVIPSLAAPSSPTTSNLTADQIVKTCEQLETDGDVDGLFRFMCTIPPQKTQEVAGNEAFLRARALVCFHASHFRELYAILENNKFSPKYHPKLQEMWHEAHYREQEKNRGKSLCAVDKYRVRKKYPMPRTIWDGEQKTHCFKERTRSLLREWYLKDPYPNPPKKKELANATGLTQMQVGNWFKNRRQRDRAAAAKNKQNIIGVELKKTSSDMSDSDDDFEDSMTDSPSPIDEPKDLSKSHIPKLSPTLLPKMATPFDMFAAAANPLMMLNLNPALYMQFHNFFNTMRNPQIDEEENSETTVEVEADIEPPKKRSKLSIDEILNIKSEVSPSQCSPCSNESLSPKRAVKTEEVKKEDDEAAEEDSRSVKSETSEDPKHSSPKSTTSQSE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
296 | Phosphorylation | KSHIPKLSPTLLPKM HHHCCCCCCCCCCCC | 23.20 | 28854356 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HM32_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HM32_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HM32_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HM32_CAEEL !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...