HM32_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HM32_CAEEL
• UniProt AC: Q23175
• Protein Name: Homeobox protein ceh-32
• Gene Name: ceh-32
• Organism: Caenorhabditis elegans.
• Sequence Length: 439
• Subcellular Localization: Nucleus.
• Protein Description: Plays a role in head morphogenesis, expression is regulated by vab-3..
• Protein Sequence: MFTPEQFTKVMSQLGNFSQLGQMFQPGNVAMLQALQANGASSTPSLFPAMPSVIPSLAAPSSPTTSNLTADQIVKTCEQLETDGDVDGLFRFMCTIPPQKTQEVAGNEAFLRARALVCFHASHFRELYAILENNKFSPKYHPKLQEMWHEAHYREQEKNRGKSLCAVDKYRVRKKYPMPRTIWDGEQKTHCFKERTRSLLREWYLKDPYPNPPKKKELANATGLTQMQVGNWFKNRRQRDRAAAAKNKQNIIGVELKKTSSDMSDSDDDFEDSMTDSPSPIDEPKDLSKSHIPKLSPTLLPKMATPFDMFAAAANPLMMLNLNPALYMQFHNFFNTMRNPQIDEEENSETTVEVEADIEPPKKRSKLSIDEILNIKSEVSPSQCSPCSNESLSPKRAVKTEEVKKEDDEAAEEDSRSVKSETSEDPKHSSPKSTTSQSE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
296	Phosphorylation	KSHIPKLSPTLLPKM HHHCCCCCCCCCCCC	23.20	28854356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HM32_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HM32_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HM32_CAEEL !!

Protein-Protein Interaction

Oops, there are no PPI records of HM32_CAEEL !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.