| UniProt ID | HLPDA_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y5L2 | |
| Protein Name | Hypoxia-inducible lipid droplet-associated protein | |
| Gene Name | HILPDA | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 63 | |
| Subcellular Localization |
Lipid droplet. Secreted. Membrane Single-pass membrane protein . |
|
| Protein Description | Increases intracellular lipid accumulation. Stimulates expression of cytokines including IL6, MIF and VEGFA. Enhances cell growth and proliferation.. | |
| Protein Sequence | MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 44 | O-linked_Glycosylation | GTSWTTRSQLANTEP CCCCCCHHHHCCCCC | 27.70 | 6435043 | |
| 44 | Phosphorylation | GTSWTTRSQLANTEP CCCCCCHHHHCCCCC | 27.70 | 18669648 | |
| 49 | O-linked_Glycosylation | TRSQLANTEPTKGLP CHHHHCCCCCCCCCC | 37.42 | 55823779 | |
| 49 | Phosphorylation | TRSQLANTEPTKGLP CHHHHCCCCCCCCCC | 37.42 | - | |
| 52 | O-linked_Glycosylation | QLANTEPTKGLPDHP HHCCCCCCCCCCCCC | 31.35 | 55823785 | |
| 53 | Ubiquitination | LANTEPTKGLPDHPS HCCCCCCCCCCCCCC | 69.99 | 21906983 | |
| 60 | O-linked_Glycosylation | KGLPDHPSRSM---- CCCCCCCCCCC---- | 33.30 | 55823789 | |
| 60 | Phosphorylation | KGLPDHPSRSM---- CCCCCCCCCCC---- | 33.30 | 22199227 | |
| 62 | O-linked_Glycosylation | LPDHPSRSM------ CCCCCCCCC------ | 32.93 | 55823795 | |
| 62 | Phosphorylation | LPDHPSRSM------ CCCCCCCCC------ | 32.93 | 23911959 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HLPDA_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HLPDA_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HLPDA_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HLPDA_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-44, AND MASSSPECTROMETRY. | |
