UniProt ID | HLPDA_HUMAN | |
---|---|---|
UniProt AC | Q9Y5L2 | |
Protein Name | Hypoxia-inducible lipid droplet-associated protein | |
Gene Name | HILPDA | |
Organism | Homo sapiens (Human). | |
Sequence Length | 63 | |
Subcellular Localization |
Lipid droplet. Secreted. Membrane Single-pass membrane protein . |
|
Protein Description | Increases intracellular lipid accumulation. Stimulates expression of cytokines including IL6, MIF and VEGFA. Enhances cell growth and proliferation.. | |
Protein Sequence | MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
44 | O-linked_Glycosylation | GTSWTTRSQLANTEP CCCCCCHHHHCCCCC | 27.70 | 6435043 | |
44 | Phosphorylation | GTSWTTRSQLANTEP CCCCCCHHHHCCCCC | 27.70 | 18669648 | |
49 | O-linked_Glycosylation | TRSQLANTEPTKGLP CHHHHCCCCCCCCCC | 37.42 | 55823779 | |
49 | Phosphorylation | TRSQLANTEPTKGLP CHHHHCCCCCCCCCC | 37.42 | - | |
52 | O-linked_Glycosylation | QLANTEPTKGLPDHP HHCCCCCCCCCCCCC | 31.35 | 55823785 | |
53 | Ubiquitination | LANTEPTKGLPDHPS HCCCCCCCCCCCCCC | 69.99 | 21906983 | |
60 | O-linked_Glycosylation | KGLPDHPSRSM---- CCCCCCCCCCC---- | 33.30 | 55823789 | |
60 | Phosphorylation | KGLPDHPSRSM---- CCCCCCCCCCC---- | 33.30 | 22199227 | |
62 | O-linked_Glycosylation | LPDHPSRSM------ CCCCCCCCC------ | 32.93 | 55823795 | |
62 | Phosphorylation | LPDHPSRSM------ CCCCCCCCC------ | 32.93 | 23911959 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HLPDA_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HLPDA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HLPDA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HLPDA_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-44, AND MASSSPECTROMETRY. |