dbPTM

HIS5_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HIS5_SCHPO
UniProt AC	O94303
Protein Name	Imidazole glycerol phosphate synthase hisHF
Gene Name	his4
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	541
Subcellular Localization
Protein Description	IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The glutamine amidotransferase domain provides the ammonia necessary to the cyclase domain to produce IGP and AICAR from PRFAR (By similarity)..
Protein Sequence	MIVSIVDYGSGNVRSLINAVRYLGFETQWIRNPHDIEKAECLIFPGVGNFGFVCDSLAKQGFLEPLRRYALSGKPFMAVCVGIQALFEGSVEAPHSKGLGVFPGLVQRFDNDDKTVPHIGWNSCAVRSDTSKEFFGMRPHDKFYFVHSYMIPEKGLILPPEFKIATTKYGNETFVGAIVKNNFLATQFHPEKSGSAGLRCLKAFLTGNYEQPISGEASKLIENSFGGLTKRIIACLDVRSNDAGDLVVTKGDQYDVREKSSGSEVRNLGKPVELCQRYFQEGADEVVFLNITSFRNCPMADAPMLQVLEKAAQTVFVPLTVGGGIRDVSDPDGTFHPAVEVAGIYFRSGADKVSIGSDAVYAAEKYYENGKKLSGKTAIETISKAYGNQAVVISVDPKRQYVKVPEDTKHHVVKTSRLGPNGEAYCWYQCTVKGGREYRDIDVVELTRACEAMGAGEVLLNCMDQDGSNAGYDIELVRLVKNSVNIPVIASSGAGIPQHFEEVFKETDCDAALAAGIFHRQTCRIEDVKEYLAIHDVLVRT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
377	Phosphorylation	GKKLSGKTAIETISK CCCCCCHHHHHHHHH	36.07	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HIS5_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HIS5_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HIS5_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of HIS5_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HIS5_SCHPO

Related Literatures of Post-Translational Modification