HIR1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HIR1_ARATH
• UniProt AC: Q9FM19
• Protein Name: Hypersensitive-induced response protein 1 {ECO:0000303|PubMed:15060130}
• Gene Name: HIR1 {ECO:0000303|PubMed:15060130}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 286
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Positive regulator of hypersensitive response (HR)-like cell death. May be involved in potassium ion channel regulation..
• Protein Sequence: MGNLFCCVQVDQSTVAIKETFGKFEDVLEPGCHFLPWCLGSQVAGYLSLRVQQLDVRCETKTKDNVFVNVVASIQYRALANKANDAYYKLSNTRGQIQAYVFDVIRASVPKLLLDDVFEQKNDIAKAVEEELEKAMSAYGYEIVQTLIVDIEPDEHVKRAMNEINAAARMRLAANEKAEAEKILQIKRAEGEAESKYLSGLGIARQRQAIVDGLRDSVLGFAVNVPGTTAKDVMDMVLVTQYFDTMKEIGASSKSSAVFIPHGPGAVRDVASQIRDGLLQGSSANL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGNLFCCVQ ------CCCEEEEEE	39.28	-
199	Phosphorylation	EAESKYLSGLGIARQ HHHHHHHHCCCHHHH	28.96	17317660
283	Phosphorylation	DGLLQGSSANL---- HHHHCCCCCCC----	28.18	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HIR1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HIR1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HIR1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of HIR1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.