dbPTM

HIG1A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HIG1A_MOUSE
UniProt AC	Q9JLR9
Protein Name	HIG1 domain family member 1A, mitochondrial
Gene Name	Higd1a
Organism	Mus musculus (Mouse).
Sequence Length	95
Subcellular Localization	Mitochondrion membrane Multi-pass membrane protein . Mitochondrion inner membrane.
Protein Description	Proposed subunit of cytochrome c oxidase (COX, complex IV), which is the terminal component of the mitochondrial respiratory chain that catalyzes the reduction of oxygen to water. May play a role in the assembly of respiratory supercomplexes (By similarity)..
Protein Sequence	MSTNTDLSLSSYDEGQGSKFIRKAKETPFVPIGMAGFAAIVAYGLYKLKSRGNTKMSIHLIHMRVAAQGFVVGAMTLGMGYSMYQEFWANPKPKP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSTNTDLSL ------CCCCCCCCC	30.30	-
2	Phosphorylation	------MSTNTDLSL ------CCCCCCCCC	30.30	28066266
3	Phosphorylation	-----MSTNTDLSLS -----CCCCCCCCCC	40.62	28066266
5	Phosphorylation	---MSTNTDLSLSSY ---CCCCCCCCCCCC	38.10	26643407
8	Phosphorylation	MSTNTDLSLSSYDEG CCCCCCCCCCCCCCC	29.08	26643407
10	Phosphorylation	TNTDLSLSSYDEGQG CCCCCCCCCCCCCCC	24.39	26643407
11	Phosphorylation	NTDLSLSSYDEGQGS CCCCCCCCCCCCCCH	41.73	28066266
12	Phosphorylation	TDLSLSSYDEGQGSK CCCCCCCCCCCCCHH	18.03	26643407
18	Phosphorylation	SYDEGQGSKFIRKAK CCCCCCCHHHHHHHC	19.26	30635358
19	Ubiquitination	YDEGQGSKFIRKAKE CCCCCCHHHHHHHCC	52.19	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HIG1A_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HIG1A_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HIG1A_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of HIG1A_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HIG1A_MOUSE

Related Literatures of Post-Translational Modification