UniProt ID | HIG1A_MOUSE | |
---|---|---|
UniProt AC | Q9JLR9 | |
Protein Name | HIG1 domain family member 1A, mitochondrial | |
Gene Name | Higd1a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 95 | |
Subcellular Localization |
Mitochondrion membrane Multi-pass membrane protein . Mitochondrion inner membrane. |
|
Protein Description | Proposed subunit of cytochrome c oxidase (COX, complex IV), which is the terminal component of the mitochondrial respiratory chain that catalyzes the reduction of oxygen to water. May play a role in the assembly of respiratory supercomplexes (By similarity).. | |
Protein Sequence | MSTNTDLSLSSYDEGQGSKFIRKAKETPFVPIGMAGFAAIVAYGLYKLKSRGNTKMSIHLIHMRVAAQGFVVGAMTLGMGYSMYQEFWANPKPKP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSTNTDLSL ------CCCCCCCCC | 30.30 | - | |
2 | Phosphorylation | ------MSTNTDLSL ------CCCCCCCCC | 30.30 | 28066266 | |
3 | Phosphorylation | -----MSTNTDLSLS -----CCCCCCCCCC | 40.62 | 28066266 | |
5 | Phosphorylation | ---MSTNTDLSLSSY ---CCCCCCCCCCCC | 38.10 | 26643407 | |
8 | Phosphorylation | MSTNTDLSLSSYDEG CCCCCCCCCCCCCCC | 29.08 | 26643407 | |
10 | Phosphorylation | TNTDLSLSSYDEGQG CCCCCCCCCCCCCCC | 24.39 | 26643407 | |
11 | Phosphorylation | NTDLSLSSYDEGQGS CCCCCCCCCCCCCCH | 41.73 | 28066266 | |
12 | Phosphorylation | TDLSLSSYDEGQGSK CCCCCCCCCCCCCHH | 18.03 | 26643407 | |
18 | Phosphorylation | SYDEGQGSKFIRKAK CCCCCCCHHHHHHHC | 19.26 | 30635358 | |
19 | Ubiquitination | YDEGQGSKFIRKAKE CCCCCCHHHHHHHCC | 52.19 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HIG1A_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HIG1A_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HIG1A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HIG1A_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...