UniProt ID | HHP1_ARATH | |
---|---|---|
UniProt AC | Q93ZH9 | |
Protein Name | Heptahelical transmembrane protein 1 | |
Gene Name | HHP1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 332 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | May act as a negative regulator of abscisic acid (ABA)-mediated osmotic stress signaling and function in cross-talk between cold and osmotic signaling.. | |
Protein Sequence | MDQNGHNDEAETVSCGNGNCKSKIVPGDDHGGDESSGTKRRKKRKTQQKTMKRRELMSYCELPEYMKDNEYILNYYRADWSIRDAFFSVFSFHNESLNVWTHLIGFIFFVALTVANIIHHDGFFPVDAKSPGNVTRWPFFVFLGGSMFCLLASSICHLFCCHSKELNVFLLRIDYAGITAMIITSFFPPIFYIFQCTPRWYFIYLAGITSMGIFTIITLFTPSLSAPKYRAFRALLFASMGLFGIVPAAHALVVNWGNPQRNVTLVYELLMAVFYLVGTGFYVGRVPERLKPGWFDRVGHSHQIFHVFVLLGALSHYAAALLFLDWRDHVGC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
35 | Phosphorylation | DDHGGDESSGTKRRK CCCCCCCCCCHHHHH | 30407730 | ||
36 | Phosphorylation | DHGGDESSGTKRRKK CCCCCCCCCHHHHHH | 25561503 | ||
38 | Phosphorylation | GGDESSGTKRRKKRK CCCCCCCHHHHHHHH | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HHP1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HHP1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HHP1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ICE1_ARATH | ICE1 | physical | 20566565 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...