| UniProt ID | HHIP_HUMAN | |
|---|---|---|
| UniProt AC | Q96QV1 | |
| Protein Name | Hedgehog-interacting protein | |
| Gene Name | HHIP | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 700 | |
| Subcellular Localization |
Cell membrane Peripheral membrane protein. Secreted. The last 22 C-terminal amino acids may participate in cell membrane attachment. Isoform 2: Cytoplasm . |
|
| Protein Description | Modulates hedgehog signaling in several cell types including brain and lung through direct interaction with members of the hedgehog family.. | |
| Protein Sequence | MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MLKMLSFKLLLLA --CHHHHHHHHHHHH | 19.48 | 24719451 | |
| 93 | Ubiquitination | GLGRLENKIFSVTNN CCCHHCCEEEEECCC | 35.43 | - | |
| 99 | N-linked_Glycosylation | NKIFSVTNNTECGKL CEEEEECCCCHHHHH | 51.80 | UniProtKB CARBOHYD | |
| 105 | Ubiquitination | TNNTECGKLLEEIKC CCCCHHHHHHHHHHH | 62.65 | - | |
| 142 | Ubiquitination | LVLPLLCKDYCKEFF CHHHHHCHHHHHHHH | 52.26 | - | |
| 174 | Ubiquitination | FCFYYARKDGGLCFP HHHHEECCCCCCCCC | 53.18 | - | |
| 247 | Ubiquitination | QRLFILEKEGYVKIL CEEEEEEECCEEEEE | 53.66 | - | |
| 250 | Phosphorylation | FILEKEGYVKILTPE EEEEECCEEEEECCC | 10.32 | 22210691 | |
| 252 | Ubiquitination | LEKEGYVKILTPEGE EEECCEEEEECCCCC | 24.42 | 29967540 | |
| 262 | Ubiquitination | TPEGEIFKEPYLDIH CCCCCCCCCCCCCHH | 64.54 | 29967540 | |
| 265 | Phosphorylation | GEIFKEPYLDIHKLV CCCCCCCCCCHHHHH | 20.35 | 22817900 | |
| 270 | Ubiquitination | EPYLDIHKLVQSGIK CCCCCHHHHHHCCCC | 51.17 | 29967540 | |
| 277 | Ubiquitination | KLVQSGIKGGDERGL HHHHCCCCCCCCCCE | 61.44 | - | |
| 293 | Phosphorylation | SLAFHPNYKKNGKLY EEEECCCCCCCCEEE | 27.99 | 22817900 | |
| 329 | Ubiquitination | VEYTVSRKNPHQVDL EEEECCCCCCCCCCH | 68.29 | - | |
| 406 | Phosphorylation | TDMCNVPYSIPRSNP CCCCCCCCCCCCCCC | 18.23 | 29083192 | |
| 407 | Phosphorylation | DMCNVPYSIPRSNPH CCCCCCCCCCCCCCC | 21.75 | 29083192 | |
| 416 | N-linked_Glycosylation | PRSNPHFNSTNQPPE CCCCCCCCCCCCCCC | 44.91 | UniProtKB CARBOHYD | |
| 447 | N-linked_Glycosylation | HPTDININLTILCSD CCCCCEEEEEEEEEC | 27.00 | 19561611 | |
| 459 | N-linked_Glycosylation | CSDSNGKNRSSARIL EECCCCCCCCHHHHH | 50.92 | UniProtKB CARBOHYD | |
| 472 | Ubiquitination | ILQIIKGKDYESEPS HHHHHCCCCCCCCCC | 52.73 | - | |
| 528 | Ubiquitination | LQQSPVTKQWQEKPL EEECCCCCCCCCCCE | 50.18 | - | |
| 533 | Ubiquitination | VTKQWQEKPLCLGTS CCCCCCCCCEEECCC | 28.34 | - | |
| 597 | O-linked_Glycosylation | MPEECRATVQPAQTL CCHHHHHCCCCHHHH | 10.58 | OGP | |
| 616 | Phosphorylation | SRLCRNGYCTPTGKC HHHHHCCEECCCCCC | 9.19 | - | |
| 618 | Phosphorylation | LCRNGYCTPTGKCCC HHHCCEECCCCCCCC | 18.53 | - | |
| 620 | Phosphorylation | RNGYCTPTGKCCCSP HCCEECCCCCCCCCC | 30.99 | - | |
| 622 | Ubiquitination | GYCTPTGKCCCSPGW CEECCCCCCCCCCCC | 26.95 | - | |
| 626 | Phosphorylation | PTGKCCCSPGWEGDF CCCCCCCCCCCCCCC | 16.72 | - | |
| 659 | Ubiquitination | PNKCLCKKGYLGPQC CCCCCCCCCCCCCHH | 52.36 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HHIP_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HHIP_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HHIP_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HHIP_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
