UniProt ID | HFE_MOUSE | |
---|---|---|
UniProt AC | P70387 | |
Protein Name | Hereditary hemochromatosis protein homolog | |
Gene Name | Hfe | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 359 | |
Subcellular Localization |
Cell membrane Single-pass type I membrane protein . |
|
Protein Description | Binds to transferrin receptor (TFR) and reduces its affinity for iron-loaded transferrin.. | |
Protein Sequence | MSLSAGLPVRPLLLLLLLLWSVAPQALPPRSHSLRYLFMGASEPDLGLPLFEARGYVDDQLFVSYNHESRRAEPRAPWILEQTSSQLWLHLSQSLKGWDYMFIVDFWTIMGNYNHSKVTKLGVVSESHILQVVLGCEVHEDNSTSGFWRYGYDGQDHLEFCPKTLNWSAAEPGAWATKVEWDEHKIRAKQNRDYLEKDCPEQLKRLLELGRGVLGQQVPTLVKVTRHWASTGTSLRCQALDFFPQNITMRWLKDNQPLDAKDVNPEKVLPNGDETYQGWLTLAVAPGDETRFTCQVEHPGLDQPLTASWEPLQSQAMIIGIISGVTVCAIFLVGILFLILRKRKASGGTMGGYVLTDCE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSLSAGLPV ------CCCCCCCCH | 30.91 | 25338131 | |
42 | Phosphorylation | RYLFMGASEPDLGLP HEEECCCCCCCCCCC | 43.89 | - | |
114 | N-linked_Glycosylation | WTIMGNYNHSKVTKL HHHHCCCCCCCCEEE | 36.64 | - | |
142 | N-linked_Glycosylation | GCEVHEDNSTSGFWR CCEEECCCCCCCCEE | 44.17 | - | |
166 | N-linked_Glycosylation | EFCPKTLNWSAAEPG EECCCCCCCCCCCCC | 35.57 | - | |
246 | N-linked_Glycosylation | ALDFFPQNITMRWLK ECCCCCCCEEEEEHH | 31.75 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HFE_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HFE_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HFE_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HFE_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...