UniProt ID | HES5_HUMAN | |
---|---|---|
UniProt AC | Q5TA89 | |
Protein Name | Transcription factor HES-5 | |
Gene Name | HES5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 166 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcriptional repressor of genes that require a bHLH protein for their transcription. Plays an important role as neurogenesis negative regulator (By similarity).. | |
Protein Sequence | MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MAPSTVAVELL ----CCCCCHHHHHC | 26.44 | 18491316 | |
5 | Phosphorylation | ---MAPSTVAVELLS ---CCCCCHHHHHCC | 16.07 | 23403867 | |
12 | Phosphorylation | TVAVELLSPKEKNRL CHHHHHCCHHHHHCC | 46.69 | 18491316 | |
34 | Phosphorylation | MRRDRINSSIEQLKL HHHHHHCHHHHHHHH | 30.26 | - | |
35 | Phosphorylation | RRDRINSSIEQLKLL HHHHHCHHHHHHHHH | 26.17 | - | |
72 | Phosphorylation | AVSYLKHSKAFVAAA HHHHHHHCCHHHHHC | 24.88 | - | |
73 | Acetylation | VSYLKHSKAFVAAAG HHHHHHCCHHHHHCC | 45.63 | 24886875 | |
82 | Acetylation | FVAAAGPKSLHQDYS HHHHCCCCCCCCCHH | 65.81 | 24886883 | |
134 | Ubiquitination | AAPAKEPKAPGAAPP CCCCCCCCCCCCCCC | 69.20 | 20972266 | |
166 | Ubiquitination | ACGLWRPW------- CCCCCCCC------- | 16.57 | 20972266 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HES5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HES5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
STAT3_HUMAN | STAT3 | physical | 15156153 | |
JAK2_HUMAN | JAK2 | physical | 15156153 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...