HES1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HES1_MOUSE
• UniProt AC: P35428
• Protein Name: Transcription factor HES-1
• Gene Name: Hes1
• Organism: Mus musculus (Mouse).
• Sequence Length: 282
• Subcellular Localization: Nucleus.
• Protein Description: Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1 (By similarity). Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity. May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage (By similarity)..
• Protein Sequence: MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQAHPALQAPPPPPPSGPAGPQHAPFAPPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTSDSMWRPWRN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	ADIMEKNSSSPVAAT HHHHCCCCCCCCCCC	43.17	26643407
11	Phosphorylation	DIMEKNSSSPVAATP HHHCCCCCCCCCCCC	48.32	23375375
12	Phosphorylation	IMEKNSSSPVAATPA HHCCCCCCCCCCCCC	24.18	26824392
17	Phosphorylation	SSSPVAATPASVNTT CCCCCCCCCCCCCCC	15.06	26643407
20	Phosphorylation	PVAATPASVNTTPDK CCCCCCCCCCCCCCC	19.66	26643407
23	Phosphorylation	ATPASVNTTPDKPKT CCCCCCCCCCCCCCC	37.23	26643407
24	Phosphorylation	TPASVNTTPDKPKTA CCCCCCCCCCCCCCH	25.04	26643407

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HES1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HES1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HES1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TLE1_HUMAN	TLE1	physical	8687460

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.