UniProt ID | HERP1_MOUSE | |
---|---|---|
UniProt AC | Q9JJK5 | |
Protein Name | Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein | |
Gene Name | Herpud1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 391 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. |
|
Protein Description | Component of the endoplasmic reticulum quality control (ERQC) system also called ER-associated degradation (ERAD) involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. Binds to ubiquilins and this interaction is required for efficient degradation of CD3D via the ERAD pathway.. | |
Protein Sequence | MEPEPQPEPVTLLVKSPNQRHRDLELSGDRSWSVSRLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLQDLLPKQEKRHVLHLVCNVKNPSKMPETSTKGAESTEQPDNSNQTQHPGDSSSDGLRQREVLRNLSPSGWENISRPEAVQQTFQGLGPGFSGYTTYGWLQLSWFQQIYARQYYMQYLAATAASGTFVPTPSAQEIPVVSTPAPAPIHNQFPAENQPANQNAAAQAVVNPGANQNLRMNAQGGPLVEEDDEINRDWLDWTYSAATFSVFLSILYFYSSLSRFLMVMGATVVMYLHHVGWFPFRQRPVQNFPDDGGPRDAANQDPNNNLQGGMDPEMEDPNRLPPDREVLDPEHTSPSFMSTAWLVFKTFFASLLPEGPPALAN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEPEPQPE -------CCCCCCCC | 20.48 | - | |
33 | Phosphorylation | LSGDRSWSVSRLKAH CCCCCCCHHHHHHHH | 16.09 | 25338131 | |
61 | Ubiquitination | QRLIYSGKLLLDHQC CCEEECCCEECCHHH | 29.98 | - | |
75 | Ubiquitination | CLQDLLPKQEKRHVL HHHHHCCHHHHHHHE | 71.68 | - | |
100 | Ubiquitination | KMPETSTKGAESTEQ HCCCCCCCCCCCCCC | 56.76 | - | |
135 | Phosphorylation | REVLRNLSPSGWENI HHHHHHCCCCCCCCC | 22.14 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HERP1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HERP1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HERP1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PKD2_MOUSE | Pkd2 | physical | 18178578 | |
NICA_MOUSE | Ncstn | physical | 21600962 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...