| UniProt ID | HERP1_MOUSE | |
|---|---|---|
| UniProt AC | Q9JJK5 | |
| Protein Name | Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein | |
| Gene Name | Herpud1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 391 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. |
|
| Protein Description | Component of the endoplasmic reticulum quality control (ERQC) system also called ER-associated degradation (ERAD) involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. Binds to ubiquilins and this interaction is required for efficient degradation of CD3D via the ERAD pathway.. | |
| Protein Sequence | MEPEPQPEPVTLLVKSPNQRHRDLELSGDRSWSVSRLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLQDLLPKQEKRHVLHLVCNVKNPSKMPETSTKGAESTEQPDNSNQTQHPGDSSSDGLRQREVLRNLSPSGWENISRPEAVQQTFQGLGPGFSGYTTYGWLQLSWFQQIYARQYYMQYLAATAASGTFVPTPSAQEIPVVSTPAPAPIHNQFPAENQPANQNAAAQAVVNPGANQNLRMNAQGGPLVEEDDEINRDWLDWTYSAATFSVFLSILYFYSSLSRFLMVMGATVVMYLHHVGWFPFRQRPVQNFPDDGGPRDAANQDPNNNLQGGMDPEMEDPNRLPPDREVLDPEHTSPSFMSTAWLVFKTFFASLLPEGPPALAN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEPEPQPE -------CCCCCCCC | 20.48 | - | |
| 33 | Phosphorylation | LSGDRSWSVSRLKAH CCCCCCCHHHHHHHH | 16.09 | 25338131 | |
| 61 | Ubiquitination | QRLIYSGKLLLDHQC CCEEECCCEECCHHH | 29.98 | - | |
| 75 | Ubiquitination | CLQDLLPKQEKRHVL HHHHHCCHHHHHHHE | 71.68 | - | |
| 100 | Ubiquitination | KMPETSTKGAESTEQ HCCCCCCCCCCCCCC | 56.76 | - | |
| 135 | Phosphorylation | REVLRNLSPSGWENI HHHHHHCCCCCCCCC | 22.14 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HERP1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HERP1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HERP1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PKD2_MOUSE | Pkd2 | physical | 18178578 | |
| NICA_MOUSE | Ncstn | physical | 21600962 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
