HEN2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HEN2_HUMAN
• UniProt AC: Q02577
• Protein Name: Helix-loop-helix protein 2
• Gene Name: NHLH2
• Organism: Homo sapiens (Human).
• Sequence Length: 135
• Subcellular Localization: Nucleus .
• Protein Description: May serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system..
• Protein Sequence: MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
75	Phosphorylation	KRRRRRATAKYRSAH HHHHHHHHHHHHHHH	23.13	30576142
84	Phosphorylation	KYRSAHATRERIRVE HHHHHHHCHHHHHHH	24.16	30576142
106	Phosphorylation	ELRKLLPTLPPDKKL HHHHHCCCCCCCCCC	52.44	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HEN2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HEN2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HEN2_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of HEN2_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.