HEMK2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HEMK2_HUMAN
• UniProt AC: Q9Y5N5
• Protein Name: HemK methyltransferase family member 2
• Gene Name: N6AMT1
• Organism: Homo sapiens (Human).
• Sequence Length: 214
• Protein Description: Heterodimeric methyltransferase that catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May play a role in the modulation of arsenic-induced toxicity. May be involved in the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid..
• Protein Sequence: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLVFNPPYVVTPPQEVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of HEMK2_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HEMK2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HEMK2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HEMK2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ERF1_YEAST	SUP45	physical	18539146
ERF3_YEAST	SUP35	physical	18539146

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.