HEM6_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HEM6_SCHPO
• UniProt AC: Q9UTE2
• Protein Name: Probable oxygen-dependent coproporphyrinogen-III oxidase
• Gene Name: hem13
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 312
• Subcellular Localization: Cytoplasm.
• Protein Description: Involved in the heme biosynthesis. Catalyzes the aerobic oxidative decarboxylation of propionate groups of rings A and B of coproporphyrinogen-III to yield the vinyl groups in protoporphyrinogen-IX (By similarity)..
• Protein Sequence: MSDITVEPIGKQMEKLILDVQQEIVAGLEAVDGQKFFQDKWTKGEGGYGISCVIQDGNVFEKGGVNTSIVQGKLNQDAVQRMRANHEGIDRTAKELPFFAAGISMVIHPRNPMAPTTHLNYRYFELVNSDGKKIWWFGGGADLTPSILFEEDGKHFHKLHKEACDRHDPTFYPRFKKWADEYFLIKHRKETRGIGGIFFDDLSEKDPQELFAFVKDCAHTFLPAYVPIMEKRKNMEFTEDDKEFQLIRRGYYAEFNVMYDRGTWFGLQAPEPRVESILMTLPLHASWRYKYEPKQERHKALLKVTHTPIEWC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSDITVEPI ------CCCCEEECC	37.41	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HEM6_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HEM6_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HEM6_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YEG9_SCHPO	SPAC26H5.09c	physical	23695164
YEG9_SCHPO	SPAC26H5.09c	physical	26771498
YBQ3_SCHPO	SPBC115.03	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.