dbPTM

HELT_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HELT_HUMAN
UniProt AC	A6NFD8
Protein Name	Hairy and enhancer of split-related protein HELT
Gene Name	HELT
Organism	Homo sapiens (Human).
Sequence Length	242
Subcellular Localization	Nucleus .
Protein Description	Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3'..
Protein Sequence	MSDKLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAPVPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPPVL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
36	Phosphorylation	CLNELGKTVPMALAK HHHHHHCHHHHHHHH	13.98	23403867
48	Acetylation	LAKQSSGKLEKAEIL HHHCCCCCCCHHHHH	12.15	-
101	Phosphorylation	CMKNLVHYLTTVERM HHHHHHHHHHHHHHH	20.30	30622161
103	Phosphorylation	KNLVHYLTTVERMET HHHHHHHHHHHHHCC	24.14	30622161
104	Phosphorylation	NLVHYLTTVERMETK HHHHHHHHHHHHCCC	21.70	30622161
110	Phosphorylation	TTVERMETKDTKYAR HHHHHHCCCCHHHHH	14.83	30622161
115	Phosphorylation	METKDTKYARILAFL HCCCCHHHHHHHHHH	25.11	29083192
124	Phosphorylation	RILAFLQSKARLGAE HHHHHHHHHHHHCCC	8.40	29083192

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HELT_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HELT_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HELT_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of HELT_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HELT_HUMAN

Related Literatures of Post-Translational Modification