dbPTM

HEBP1_CHICK - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HEBP1_CHICK
UniProt AC	Q5ZMB2
Protein Name	Heme-binding protein 1
Gene Name	HEBP1
Organism	Gallus gallus (Chicken).
Sequence Length	189
Subcellular Localization	Cytoplasm.
Protein Description	May bind free porphyrinogens that may be present in the cell and thus facilitate removal of these potentially toxic compound. Binds with a high affinity to one molecule of heme or porphyrins. It binds metalloporphyrins, free porphyrins and N-methylprotoporphyrin with similar affinities (By similarity)..
Protein Sequence	MLGMIKNSLLSTVETWPYRVLSKGEKEQLSYEERECEGGQFAVVEVTGKPFDEASKEAALKLLKYVGGSNDKGAGMGMTAPVSITAFPAEDGSLQQKVKVYLRIPNQFQASPPCPSDESIKIEERQGMTIYSTQFGGYAKEVDYVNYAAKLKTALGSEAAYRKDFYFCNGYDPPMKPYGRRNEVWFVKE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of HEBP1_CHICK !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HEBP1_CHICK !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HEBP1_CHICK !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HEBP1_CHICK !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of HEBP1_CHICK !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HEBP1_CHICK

Related Literatures of Post-Translational Modification