| UniProt ID | HDC_HUMAN | |
|---|---|---|
| UniProt AC | Q9UBI9 | |
| Protein Name | Headcase protein homolog | |
| Gene Name | HECA | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 543 | |
| Subcellular Localization | ||
| Protein Description | May play an important role in some human cancers. May be part of the regulatory mechanism in the development of epithelial tube networks such as the circulatory system and lungs.. | |
| Protein Sequence | MPNPKNSKGGRKNKRANSSGDEQENGAGALAAAGAAGAAAGGALAAAAGCGAAAAGAPGAGGAAGAGGAGTGAANAAAAAGAAAAGDAKNEAPCATPLICSFGRPVDLEKDDYQKVVCNNEHCPCSTWMHLQCFYEWESSILVQFNCIGRARSWNEKQCRQNMWTKKGYDLAFRFCSCRCGQGHLKKDTDWYQVKRMQDEKKKKSGSEKNTGRPPGEAAEEAKKCRPPNKPQKGPSHDLPRRHSMDRQNSQEKAVGAAAYGARSPGGSPGQSPPTGYSILSPAHFSGPRSSRYLGEFLKNAIHLEPHKKAMAGGHVFRNAHFDYSPAGLAVHRGGHFDTPVQFLRRLDLSELLTHIPRHKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVFEQFPLVDGTLFLSPSRHDEIEYDVPCHLQGRLMHLYAVCVDCLEGVHKIICIKCKSRWDGSWHQLGTMYTYDILAASPCCQARLNCKHCGKPVIDVRIGMQYFSEYSNVQQCPHCGNLDYHFVKPFSSFKVLEAY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 110 | Ubiquitination | GRPVDLEKDDYQKVV CCCCCCCCCCCCEEE | 64.30 | 29967540 | |
| 195 | Methylation | DTDWYQVKRMQDEKK CCCHHHHHHHHHHHH | 26.99 | - | |
| 195 | Ubiquitination | DTDWYQVKRMQDEKK CCCHHHHHHHHHHHH | 26.99 | 29967540 | |
| 244 | Phosphorylation | HDLPRRHSMDRQNSQ CCCCCCCCCCCCCHH | 22.14 | 24719451 | |
| 250 | Phosphorylation | HSMDRQNSQEKAVGA CCCCCCCHHHHHHHH | 31.23 | 24719451 | |
| 260 | Phosphorylation | KAVGAAAYGARSPGG HHHHHHHHCCCCCCC | 13.44 | 22199227 | |
| 264 | Phosphorylation | AAAYGARSPGGSPGQ HHHHCCCCCCCCCCC | 27.62 | 26055452 | |
| 268 | Phosphorylation | GARSPGGSPGQSPPT CCCCCCCCCCCCCCC | 31.60 | 26055452 | |
| 272 | Phosphorylation | PGGSPGQSPPTGYSI CCCCCCCCCCCCCCC | 38.47 | 26055452 | |
| 275 | Phosphorylation | SPGQSPPTGYSILSP CCCCCCCCCCCCCCC | 52.73 | 22115753 | |
| 277 | Phosphorylation | GQSPPTGYSILSPAH CCCCCCCCCCCCCHH | 8.60 | 17081983 | |
| 278 | Phosphorylation | QSPPTGYSILSPAHF CCCCCCCCCCCCHHH | 20.56 | 17081983 | |
| 281 | Phosphorylation | PTGYSILSPAHFSGP CCCCCCCCCHHHCCC | 20.54 | 28450419 | |
| 286 | Phosphorylation | ILSPAHFSGPRSSRY CCCCHHHCCCCHHHH | 37.71 | 28450419 | |
| 289 | Methylation | PAHFSGPRSSRYLGE CHHHCCCCHHHHHHH | 51.28 | 115478411 | |
| 324 | Phosphorylation | FRNAHFDYSPAGLAV EECCCCCCCCCCEEE | 18.66 | 28122231 | |
| 325 | Phosphorylation | RNAHFDYSPAGLAVH ECCCCCCCCCCEEEC | 15.32 | 28122231 | |
| 333 | Methylation | PAGLAVHRGGHFDTP CCCEEECCCCCCCCH | 46.30 | 115478405 | |
| 389 | O-linked_Glycosylation | KFILAALSASHRNVV HHHHHHHCHHCCHHH | 24.01 | 29351928 | |
| 391 | O-linked_Glycosylation | ILAALSASHRNVVNC HHHHHCHHCCHHHHH | 21.43 | 29351928 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HDC_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HDC_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HDC_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HDC_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-264 AND SER-268, ANDMASS SPECTROMETRY. | |
| "A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-264; SER-268 ANDSER-272, AND MASS SPECTROMETRY. | |
