UniProt ID | HBE_MOUSE | |
---|---|---|
UniProt AC | P02104 | |
Protein Name | Hemoglobin subunit epsilon-Y2 | |
Gene Name | Hbb-y | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 147 | |
Subcellular Localization | ||
Protein Description | Hemoglobin epsilon chain is a beta-type chain found in early embryos.. | |
Protein Sequence | MVNFTAEEKTLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLSSASAIMGNPRVKAHGKKVLTAFGESIKNLDNLKSALAKLSELHCDKLHVDPENFKLLGNVLVIVLASHFGNEFTAEMQAAWQKLVAGVATALSHKYH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MVNFTAEEKTLI ---CCCCCHHHHHHH | 28.14 | 29514104 | |
31 | Dimethylation | VGGEALGRLLVVYPW HCHHHHHHHEEHHHC | 26.21 | - | |
36 | Phosphorylation | LGRLLVVYPWTQRFF HHHHEEHHHCHHHHH | 5.88 | 27180971 | |
39 | Phosphorylation | LLVVYPWTQRFFDSF HEEHHHCHHHHHHHC | 12.83 | 23737553 | |
41 | Methylation | VVYPWTQRFFDSFGN EHHHCHHHHHHHCCC | 27.16 | - | |
50 | Phosphorylation | FDSFGNLSSASAIMG HHHCCCCCCHHHHHC | 28.05 | 28059163 | |
51 | Phosphorylation | DSFGNLSSASAIMGN HHCCCCCCHHHHHCC | 29.43 | 28059163 | |
90 | Phosphorylation | KSALAKLSELHCDKL HHHHHHHHHHCCCCC | 37.09 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HBE_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HBE_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HBE_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HBE_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...