UniProt ID | HBA_BOVIN | |
---|---|---|
UniProt AC | P01966 | |
Protein Name | Hemoglobin subunit alpha | |
Gene Name | HBA | |
Organism | Bos taurus (Bovine). | |
Sequence Length | 142 | |
Subcellular Localization | ||
Protein Description | Involved in oxygen transport from the lung to the various peripheral tissues.. | |
Protein Sequence | MVLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGAKVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MVLSAADKGNV ----CCCCHHHCCCC | 15.25 | - | |
8 | Succinylation | MVLSAADKGNVKAAW CCCCHHHCCCCCCCC | 47.89 | - | |
8 | Succinylation | MVLSAADKGNVKAAW CCCCHHHCCCCCCCC | 47.89 | - | |
12 | Succinylation | AADKGNVKAAWGKVG HHHCCCCCCCCCCCC | 36.07 | - | |
12 | Succinylation | AADKGNVKAAWGKVG HHHCCCCCCCCCCCC | 36.07 | - | |
17 | Acetylation | NVKAAWGKVGGHAAE CCCCCCCCCCHHHHH | 27.31 | - | |
17 | Succinylation | NVKAAWGKVGGHAAE CCCCCCCCCCHHHHH | 27.31 | - | |
17 | Succinylation | NVKAAWGKVGGHAAE CCCCCCCCCCHHHHH | 27.31 | - | |
25 | Phosphorylation | VGGHAAEYGAEALER CCHHHHHHHHHHHHH | 19.53 | - | |
36 | Phosphorylation | ALERMFLSFPTTKTY HHHHHHHHCCCCCCC | 20.22 | - | |
41 | Succinylation | FLSFPTTKTYFPHFD HHHCCCCCCCCCCCC | 43.64 | - | |
41 | Succinylation | FLSFPTTKTYFPHFD HHHCCCCCCCCCCCC | 43.64 | - | |
50 | Phosphorylation | YFPHFDLSHGSAQVK CCCCCCCCCCCEEEC | 27.87 | - | |
53 | Phosphorylation | HFDLSHGSAQVKGHG CCCCCCCCEEECCHH | 15.31 | 29541418 | |
100 | Acetylation | RVDPVNFKLLSHSLL CCCCCCHHHHHHHHH | 43.23 | - | |
103 | Phosphorylation | PVNFKLLSHSLLVTL CCCHHHHHHHHHHHH | 22.82 | - | |
109 | Phosphorylation | LSHSLLVTLASHLPS HHHHHHHHHHHCCCC | 19.31 | - | |
125 | Phosphorylation | FTPAVHASLDKFLAN CCHHHHHHHHHHHHH | 23.40 | - | |
135 | Phosphorylation | KFLANVSTVLTSKYR HHHHHHHHHHHCCCC | 18.43 | - | |
138 | Phosphorylation | ANVSTVLTSKYR--- HHHHHHHHCCCC--- | 20.88 | - | |
139 | Phosphorylation | NVSTVLTSKYR---- HHHHHHHCCCC---- | 24.43 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HBA_BOVIN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HBA_BOVIN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HBA_BOVIN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HBA_BOVIN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...