| UniProt ID | HBA_BOVIN | |
|---|---|---|
| UniProt AC | P01966 | |
| Protein Name | Hemoglobin subunit alpha | |
| Gene Name | HBA | |
| Organism | Bos taurus (Bovine). | |
| Sequence Length | 142 | |
| Subcellular Localization | ||
| Protein Description | Involved in oxygen transport from the lung to the various peripheral tissues.. | |
| Protein Sequence | MVLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGAKVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MVLSAADKGNV ----CCCCHHHCCCC | 15.25 | - | |
| 8 | Succinylation | MVLSAADKGNVKAAW CCCCHHHCCCCCCCC | 47.89 | - | |
| 8 | Succinylation | MVLSAADKGNVKAAW CCCCHHHCCCCCCCC | 47.89 | - | |
| 12 | Succinylation | AADKGNVKAAWGKVG HHHCCCCCCCCCCCC | 36.07 | - | |
| 12 | Succinylation | AADKGNVKAAWGKVG HHHCCCCCCCCCCCC | 36.07 | - | |
| 17 | Acetylation | NVKAAWGKVGGHAAE CCCCCCCCCCHHHHH | 27.31 | - | |
| 17 | Succinylation | NVKAAWGKVGGHAAE CCCCCCCCCCHHHHH | 27.31 | - | |
| 17 | Succinylation | NVKAAWGKVGGHAAE CCCCCCCCCCHHHHH | 27.31 | - | |
| 25 | Phosphorylation | VGGHAAEYGAEALER CCHHHHHHHHHHHHH | 19.53 | - | |
| 36 | Phosphorylation | ALERMFLSFPTTKTY HHHHHHHHCCCCCCC | 20.22 | - | |
| 41 | Succinylation | FLSFPTTKTYFPHFD HHHCCCCCCCCCCCC | 43.64 | - | |
| 41 | Succinylation | FLSFPTTKTYFPHFD HHHCCCCCCCCCCCC | 43.64 | - | |
| 50 | Phosphorylation | YFPHFDLSHGSAQVK CCCCCCCCCCCEEEC | 27.87 | - | |
| 53 | Phosphorylation | HFDLSHGSAQVKGHG CCCCCCCCEEECCHH | 15.31 | 29541418 | |
| 100 | Acetylation | RVDPVNFKLLSHSLL CCCCCCHHHHHHHHH | 43.23 | - | |
| 103 | Phosphorylation | PVNFKLLSHSLLVTL CCCHHHHHHHHHHHH | 22.82 | - | |
| 109 | Phosphorylation | LSHSLLVTLASHLPS HHHHHHHHHHHCCCC | 19.31 | - | |
| 125 | Phosphorylation | FTPAVHASLDKFLAN CCHHHHHHHHHHHHH | 23.40 | - | |
| 135 | Phosphorylation | KFLANVSTVLTSKYR HHHHHHHHHHHCCCC | 18.43 | - | |
| 138 | Phosphorylation | ANVSTVLTSKYR--- HHHHHHHHCCCC--- | 20.88 | - | |
| 139 | Phosphorylation | NVSTVLTSKYR---- HHHHHHHCCCC---- | 24.43 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HBA_BOVIN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HBA_BOVIN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HBA_BOVIN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HBA_BOVIN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...