UniProt ID | HBAZ_MOUSE | |
---|---|---|
UniProt AC | P06467 | |
Protein Name | Hemoglobin subunit zeta | |
Gene Name | Hbz | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 142 | |
Subcellular Localization | ||
Protein Description | The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin.. | |
Protein Sequence | MSLMKNERAIIMSMWEKMAAQAEPIGTETLERLFCSYPQTKTYFPHFDLHHGSQQLRAHGFKIMTAVGDAVKSIDNLSSALTKLSELHAYILRVDPVNFKLLSHCLLVTMAARFPADFTPEVHEAWDKFMSILSSILTEKYR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSLMKNERA ------CCCHHHHHH | 36.85 | - | |
29 | Phosphorylation | AEPIGTETLERLFCS CCCCCHHHHHHHHCC | 33.48 | - | |
53 | Phosphorylation | HFDLHHGSQQLRAHG CCCCCCCHHHHHHCC | 15.47 | - | |
73 | Phosphorylation | AVGDAVKSIDNLSSA HHHHHHHCHHCHHHH | 28.68 | - | |
100 | Acetylation | RVDPVNFKLLSHCLL CCCCCCHHHHHHHHH | 43.23 | 7665095 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HBAZ_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HBAZ_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HBAZ_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HBAZ_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...