HB2A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HB2A_MOUSE
• UniProt AC: P14483
• Protein Name: H-2 class II histocompatibility antigen, A beta chain
• Gene Name: H2-Ab1
• Organism: Mus musculus (Mouse).
• Sequence Length: 265
• Subcellular Localization: Membrane ; Single-pass type I membrane protein .
• Protein Sequence: MALQIPSLLLSAAVVVLMVLSSPGTEGGDSERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQSESAWSKMLSGIGGCVLGVIFLGLGLFIRHRSQKGPRGPPPAGLLQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
46	N-linked_Glycosylation	MGECYFTNGTQRIRY EEEEEECCCCCEEEE	41.43	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	Marchf1	Q6NZQ8	PMID:22199232
-	K	Ubiquitination	E3 ubiquitin ligase	Marchf8	Q9DBD2	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HB2A_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HB2A_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of HB2A_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.