dbPTM

HARC1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HARC1_ARATH
UniProt AC	Q8RUD6
Protein Name	Protein HIGH ARSENIC CONTENT 1, mitochondrial {ECO:0000303\|PubMed:25464340}
Gene Name	HAC1 {ECO:0000303\|PubMed:25464340}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	169
Subcellular Localization	Mitochondrion .
Protein Description	Arsenate reductase critical for arsenic tolerance. [PubMed: 25099865 Reduces arsenate to arsenite in the root, facilitating efflux of arsenic back into the soil to limit both its accumulation in the root and transport to the shoot]
Protein Sequence	MYTYSLLNLSHCRRQTRKKRKTDHTEGFLMEETKPKTVEDVETVDVYTAKGFLSTGHRYLDVRTNEEFAKSHVEEALNIPYMFKTDEGRVINPDFLSQVASVCKKDEHLIVACNAGGRGSRACVDLLNEGYDHVANMGGGYSAWVDAGFAGDKPPEDLKIACKFRPKEN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of HARC1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HARC1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HARC1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HARC1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of HARC1_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HARC1_ARATH

Related Literatures of Post-Translational Modification