| UniProt ID | HAGHL_HUMAN | |
|---|---|---|
| UniProt AC | Q6PII5 | |
| Protein Name | Hydroxyacylglutathione hydrolase-like protein | |
| Gene Name | HAGHL | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 290 | |
| Subcellular Localization | ||
| Protein Description | Hydrolase acting on ester bonds.. | |
| Protein Sequence | MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLRPGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAGCGSCLEGSAQQMYQSLAELGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKARPLSRRGKRVGGEGTGFGVGGALRQGLMVTGACGHSRRGMRMTCPLCRRLWARSASTTPSCGWREYGCCPGASTVTWTLRKASGDCVLG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 34 | Ubiquitination | AVDVAVPKRLLEIVG CCCEECCHHHHHHHC | 49.43 | 2189047 | |
| 34 (in isoform 2) | Ubiquitination | - | 49.43 | 21890473 | |
| 34 (in isoform 1) | Ubiquitination | - | 49.43 | 21890473 | |
| 34 (in isoform 3) | Ubiquitination | - | 49.43 | 21890473 | |
| 34 (in isoform 4) | Ubiquitination | - | 49.43 | 21890473 | |
| 274 | Phosphorylation | YGCCPGASTVTWTLR CCCCCCCCEEEEEEE | 29.35 | 25278378 | |
| 275 | Phosphorylation | GCCPGASTVTWTLRK CCCCCCCEEEEEEEH | 22.78 | 25278378 | |
| 277 | Phosphorylation | CPGASTVTWTLRKAS CCCCCEEEEEEEHHC | 16.90 | 25278378 | |
| 279 | Phosphorylation | GASTVTWTLRKASGD CCCEEEEEEEHHCCC | 13.81 | 25278378 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HAGHL_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HAGHL_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HAGHL_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HAGHL_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
