HACD2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HACD2_MOUSE
• UniProt AC: Q9D3B1
• Protein Name: Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 {ECO:0000305}
• Gene Name: Hacd2 {ECO:0000312|MGI:MGI:1918007}
• Organism: Mus musculus (Mouse).
• Sequence Length: 254
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators..
• Protein Sequence: MAAAAATAATKGNGGGSGRVGAGDSSGARKKKGPGPVATAYLVIYNVVMTAGWLVIAVGLVRAYLAKGSYHSLYYSIERPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYIIKWARYTLFIVLYPMGVTGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYHAFLILIMISYIPLFPQLYFHMIHQRRKVLSHTEEHKKFE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAAAAATAA ------CCCHHHCCC	13.05	-
25	Phosphorylation	GRVGAGDSSGARKKK CCCCCCCCCCCCCCC	29.74	27818261
26	Phosphorylation	RVGAGDSSGARKKKG CCCCCCCCCCCCCCC	41.01	23684622
209	N-linked_Glycosylation	ISLPNKYNFSFDYHA EECCCCCCCCCCHHH	27.91	-
251	Ubiquitination	LSHTEEHKKFE---- HHCCHHHHCCC----	63.54	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HACD2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HACD2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HACD2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of HACD2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.