UniProt ID | HA10_MOUSE | |
---|---|---|
UniProt AC | P01898 | |
Protein Name | H-2 class I histocompatibility antigen, Q10 alpha chain | |
Gene Name | H2-Q10 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 325 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein. |
|
Protein Description | Involved in the presentation of foreign antigens to the immune system.. | |
Protein Sequence | MGAMAPRTLLLLLAAALAPTQTQAGSHSMRYFETSVSRPGLGEPRFIIVGYVDDTQFVRFDSDAETPRMEPRAPWMEQEGPEYWERETQRAKGNEQSFHVSLRTLLGYYNQSESGSHTIQWMYGCKVGSDGRFLRGYLQYAYDGRDYIALNEDLKTWTAADVAAIITRRKWEQAGAAEYYRAYLEAECVEWLLRYLELGKETLLRTDPPKTHVTHHPGSEGDVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRWEPPPSTDSIMSHIADLLWPSLKLWWYL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
35 | Phosphorylation | SMRYFETSVSRPGLG HHEEEEEECCCCCCC | 15.76 | - | |
92 | Ubiquitination | ERETQRAKGNEQSFH HHHHHHHCCCCHHHE | 65.54 | - | |
110 | N-linked_Glycosylation | RTLLGYYNQSESGSH HHHHHCCCCCCCCCE | 30.34 | 17330941 | |
170 | Ubiquitination | AAIITRRKWEQAGAA HHHHHHHHHHHHCHH | 52.36 | - | |
200 | Ubiquitination | LRYLELGKETLLRTD HHHHHHCHHHHCCCC | 61.21 | 27667366 | |
210 | Ubiquitination | LLRTDPPKTHVTHHP HCCCCCCCCCCCCCC | 57.56 | - | |
267 | Ubiquitination | AGDGTFQKWASVVVP CCCCCCCEEEEEEEE | 40.30 | - | |
280 | N-linked_Glycosylation | VPLGKEQNYTCHVYH EECCCCCCEEEEEEE | 34.86 | 17330941 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HA10_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HA10_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HA10_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HA10_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides."; Bernhard O.K., Kapp E.A., Simpson R.J.; J. Proteome Res. 6:987-995(2007). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-110 AND ASN-280, AND MASSSPECTROMETRY. |