| UniProt ID | H4_DROME | |
|---|---|---|
| UniProt AC | P84040 | |
| Protein Name | Histone H4 | |
| Gene Name | His4 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 103 | |
| Subcellular Localization | Nucleus. Chromosome. | |
| Protein Description | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.. | |
| Protein Sequence | MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Acetylation | --MTGRGKGGKGLGK --CCCCCCCCCCCCC | 64.23 | 19608861 | |
| 9 | Acetylation | TGRGKGGKGLGKGGA CCCCCCCCCCCCCHH | 60.68 | 15188406 | |
| 13 | Acetylation | KGGKGLGKGGAKRHR CCCCCCCCCHHHHHH | 60.25 | 19608861 | |
| 17 | Acetylation | GLGKGGAKRHRKVLR CCCCCHHHHHHHHHH | 52.60 | 15188406 | |
| 32 | Acetylation | DNIQGITKPAIRRLA HHCCCCCHHHHHHHH | 30.45 | 21791702 | |
| 32 | Succinylation | DNIQGITKPAIRRLA HHCCCCCHHHHHHHH | 30.45 | 22389435 | |
| 48 | Phosphorylation | RGGVKRISGLIYEET CCCCCEEECCCHHHH | 31.42 | 19429919 | |
| 78 | Succinylation | VTYTEHAKRKTVTAM HHCCHHHCCCEECHH | 57.23 | 22389435 | |
| 80 | Acetylation | YTEHAKRKTVTAMDV CCHHHCCCEECHHHH | 46.79 | 21791702 | |
| 80 | Succinylation | YTEHAKRKTVTAMDV CCHHHCCCEECHHHH | 46.79 | 22389435 | |
| 81 | Phosphorylation | TEHAKRKTVTAMDVV CHHHCCCEECHHHHH | 27.41 | 22817900 | |
| 83 | Phosphorylation | HAKRKTVTAMDVVYA HHCCCEECHHHHHHH | 22.84 | 22817900 | |
| 92 | Succinylation | MDVVYALKRQGRTLY HHHHHHHHHCCCCEE | 34.21 | 22389435 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of H4_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of H4_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H4_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of H4_DROME !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "A histone code in meiosis: the histone kinase, NHK-1, is required forproper chromosomal architecture in Drosophila oocytes."; Ivanovska I., Khandan T., Ito T., Orr-Weaver T.L.; Genes Dev. 19:2571-2582(2005). Cited for: ACETYLATION AT LYS-6 AND LYS-13. | |
| Phosphorylation | |
| Reference | PubMed |
| "Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-81 AND THR-83, AND MASSSPECTROMETRY. | |
