UniProt ID | H33L3_CAEEL | |
---|---|---|
UniProt AC | Q27489 | |
Protein Name | Putative histone H3.3-like type 3 | |
Gene Name | his-69 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 127 | |
Subcellular Localization | Nucleus. Chromosome. | |
Protein Description | Putative variant histone H3 which may replace conventional H3 in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling (By similarity).. | |
Protein Sequence | MCPGGKAPRKQLATKAARKNAIVVGAVKKPHRFRPGTVALREIRRYQKSTDLLLRKLPFQRLVREIAQDVKQDLRFQSAAIQALQEASEYFLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIRGERN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Acetylation | --MCPGGKAPRKQLA --CCCCCCCCHHHHH | 62.22 | - | |
15 | Acetylation | PRKQLATKAARKNAI CHHHHHHHHHHCCCE | 34.15 | - | |
19 | Methylation | LATKAARKNAIVVGA HHHHHHHCCCEEEEC | 46.10 | - | |
28 | Methylation | AIVVGAVKKPHRFRP CEEEECCCCCCCCCC | 61.11 | - | |
71 | Methylation | REIAQDVKQDLRFQS HHHHHHHHHHHHHHH | 46.51 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of H33L3_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of H33L3_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H33L3_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of H33L3_CAEEL !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...