UniProt ID | H331_CAEEL | |
---|---|---|
UniProt AC | Q10453 | |
Protein Name | Histone H3.3 type 1 | |
Gene Name | his-71 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 136 | |
Subcellular Localization | Nucleus. Chromosome. | |
Protein Description | Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes. Constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. Deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.. | |
Protein Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Acetylation | ---MARTKQTARKST ---CCCCCHHHHHCC | 39.85 | - | |
5 | Methylation | ---MARTKQTARKST ---CCCCCHHHHHCC | 39.85 | - | |
5 | "N6,N6,N6-trimethyllysine" | ---MARTKQTARKST ---CCCCCHHHHHCC | 39.85 | - | |
10 | Methylation | RTKQTARKSTGGKAP CCCHHHHHCCCCCCC | 50.32 | - | |
10 | Acetylation | RTKQTARKSTGGKAP CCCHHHHHCCCCCCC | 50.32 | - | |
10 | "N6,N6,N6-trimethyllysine" | RTKQTARKSTGGKAP CCCHHHHHCCCCCCC | 50.32 | - | |
11 | Phosphorylation | TKQTARKSTGGKAPR CCHHHHHCCCCCCCH | 27.08 | 14702046 | |
12 | Phosphorylation | KQTARKSTGGKAPRK CHHHHHCCCCCCCHH | 53.65 | 19530675 | |
15 | Acetylation | ARKSTGGKAPRKQLA HHHCCCCCCCHHHHH | 57.47 | - | |
24 | Acetylation | PRKQLATKAARKSAP CHHHHHHHHHHHHCC | 34.15 | - | |
28 | "N6,N6,N6-trimethyllysine" | LATKAARKSAPTTGG HHHHHHHHHCCCCCC | 46.36 | - | |
28 | Methylation | LATKAARKSAPTTGG HHHHHHHHHCCCCCC | 46.36 | - | |
29 | Phosphorylation | ATKAARKSAPTTGGV HHHHHHHHCCCCCCC | 33.65 | - | |
37 | "N6,N6,N6-trimethyllysine" | APTTGGVKKPHRYRP CCCCCCCCCCCCCCC | 64.95 | - | |
37 | Methylation | APTTGGVKKPHRYRP CCCCCCCCCCCCCCC | 64.95 | - | |
58 | Phosphorylation | EIRRYQKSTELLIRK HHHHHHHCHHHHHHH | 16.16 | 19530675 | |
59 | Phosphorylation | IRRYQKSTELLIRKL HHHHHHCHHHHHHHC | 37.37 | 19530675 | |
80 | Methylation | REIAQDFKTDLRFQS HHHHHHHHHCHHHHH | 49.79 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of H331_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of H331_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H331_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...