| UniProt ID | H2B_DROME | |
|---|---|---|
| UniProt AC | P02283 | |
| Protein Name | Histone H2B | |
| Gene Name | His2B | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 123 | |
| Subcellular Localization | Nucleus. Chromosome. | |
| Protein Description | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.. | |
| Protein Sequence | MPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Methylation | ------MPPKTSGKA ------CCCCCCHHH | 38.81 | 3127388 | |
| 8 | Acetylation | MPPKTSGKAAKKAGK CCCCCCHHHHHHHHH | 44.96 | 21791702 | |
| 11 | Acetylation | KTSGKAAKKAGKAQK CCCHHHHHHHHHHHH | 48.27 | 21791702 | |
| 12 | Acetylation | TSGKAAKKAGKAQKN CCHHHHHHHHHHHHC | 58.61 | 21791702 | |
| 15 | Acetylation | KAAKKAGKAQKNITK HHHHHHHHHHHCCCC | 53.13 | 21791702 | |
| 18 | Acetylation | KKAGKAQKNITKTDK HHHHHHHHCCCCCCH | 56.00 | 21791702 | |
| 21 | Phosphorylation | GKAQKNITKTDKKKK HHHHHCCCCCCHHHH | 36.97 | 22817900 | |
| 22 | Acetylation | KAQKNITKTDKKKKR HHHHCCCCCCHHHHH | 51.43 | 21791702 | |
| 34 | Phosphorylation | KKRKRKESYAIYIYK HHHHHHHHHHHHHHH | 23.93 | 22817900 | |
| 44 | Succinylation | IYIYKVLKQVHPDTG HHHHHHHHHHCCCCC | 53.94 | 22389435 | |
| 44 | Acetylation | IYIYKVLKQVHPDTG HHHHHHHHHHCCCCC | 53.94 | 21791702 | |
| 54 | Phosphorylation | HPDTGISSKAMSIMN CCCCCCCHHHHHHHH | 23.63 | 27794539 | |
| 85 | Phosphorylation | LAHYNKRSTITSREI HHHHCCCCCCCHHHH | 26.27 | 27626673 | |
| 88 | Phosphorylation | YNKRSTITSREIQTA HCCCCCCCHHHHHHH | 23.09 | 27626673 | |
| 106 | Acetylation | LLPGELAKHAVSEGT HCCHHHHHHHHHHHH | 44.73 | 21791702 | |
| 106 | Ubiquitination | LLPGELAKHAVSEGT HCCHHHHHHHHHHHH | 44.73 | 31113955 | |
| 110 | O-linked_Glycosylation | ELAKHAVSEGTKAVT HHHHHHHHHHHHHHH | 30.96 | - | |
| 114 | Succinylation | HAVSEGTKAVTKYTS HHHHHHHHHHHHHCC | 52.28 | 22389435 | |
| 118 | Succinylation | EGTKAVTKYTSSK-- HHHHHHHHHCCCC-- | 39.67 | 22389435 | |
| 118 | Acetylation | EGTKAVTKYTSSK-- HHHHHHHHHCCCC-- | 39.67 | 21791702 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of H2B_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H2B_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of H2B_DROME !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Methylation | |
| Reference | PubMed |
| "Methylation of Drosophila histones at proline, lysine, and arginineresidues during heat shock."; Desrosiers R., Tanguay R.M.; J. Biol. Chem. 263:4686-4692(1988). Cited for: METHYLATION AT PRO-2. | |
| Phosphorylation | |
| Reference | PubMed |
| "TAF1 activates transcription by phosphorylation of serine 33 inhistone H2B."; Maile T., Kwoczynski S., Katzenberger R.J., Wassarman D.A., Sauer F.; Science 304:1010-1014(2004). Cited for: PHOSPHORYLATION AT SER-34. | |