H2BFM_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: H2BFM_HUMAN
• UniProt AC: P0C1H6
• Protein Name: Histone H2B type F-M
• Gene Name: H2BFM
• Organism: Homo sapiens (Human).
• Sequence Length: 154
• Subcellular Localization: Nucleus. Chromosome.
• Protein Description: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling..
• Protein Sequence: MAAASAMAEASSETTSEEGQSIQEPKEANSTKAQKQKRRGCRGSRRRHANRRGDSFGDSFTPYFPRVLKQVHQGLSLSQEAVSVMDSMIHDILDRIATEAGQLAHYTKRVTITSRDIQMAVRLLLPGKMGKLAEAQGTNAALRTSLCAIWQQRK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
111	Phosphorylation	AHYTKRVTITSRDIQ HHHHCCEEECHHHHH	14.66	18669648
113	Phosphorylation	YTKRVTITSRDIQMA HHCCEEECHHHHHHH	14.60	18669648

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of H2BFM_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of H2BFM_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of H2BFM_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of H2BFM_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.