| UniProt ID | H2B1_RAT | |
|---|---|---|
| UniProt AC | Q00715 | |
| Protein Name | Histone H2B type 1 | |
| Gene Name | ||
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 125 | |
| Subcellular Localization | Nucleus. Chromosome. | |
| Protein Description | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.; Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid (By similarity).. | |
| Protein Sequence | MPEPAKSRPAPKKGSKKAVTKAQKKDGKERKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGERRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MPEPAKSRP ------CCCCCCCCC | 57.17 | - | |
| 6 | Acetylation | --MPEPAKSRPAPKK --CCCCCCCCCCCCC | 58.68 | 16283522 | |
| 6 | N6-crotonyl-L-lysine | --MPEPAKSRPAPKK --CCCCCCCCCCCCC | 58.68 | - | |
| 6 | Butyrylation | --MPEPAKSRPAPKK --CCCCCCCCCCCCC | 58.68 | - | |
| 6 | Lactoylation | --MPEPAKSRPAPKK --CCCCCCCCCCCCC | 58.68 | - | |
| 6 | Other | --MPEPAKSRPAPKK --CCCCCCCCCCCCC | 58.68 | - | |
| 6 | Crotonylation | --MPEPAKSRPAPKK --CCCCCCCCCCCCC | 58.68 | - | |
| 12 | Crotonylation | AKSRPAPKKGSKKAV CCCCCCCCCCCHHHH | 72.39 | - | |
| 12 | Other | AKSRPAPKKGSKKAV CCCCCCCCCCCHHHH | 72.39 | - | |
| 12 | Lactoylation | AKSRPAPKKGSKKAV CCCCCCCCCCCHHHH | 72.39 | - | |
| 12 | N6-crotonyl-L-lysine | AKSRPAPKKGSKKAV CCCCCCCCCCCHHHH | 72.39 | - | |
| 12 | Acetylation | AKSRPAPKKGSKKAV CCCCCCCCCCCHHHH | 72.39 | 25786129 | |
| 13 | Other | KSRPAPKKGSKKAVT CCCCCCCCCCHHHHH | 68.32 | - | |
| 13 | Crotonylation | KSRPAPKKGSKKAVT CCCCCCCCCCHHHHH | 68.32 | - | |
| 13 | N6-crotonyl-L-lysine | KSRPAPKKGSKKAVT CCCCCCCCCCHHHHH | 68.32 | - | |
| 13 | Acetylation | KSRPAPKKGSKKAVT CCCCCCCCCCHHHHH | 68.32 | 16283522 | |
| 15 | Phosphorylation | RPAPKKGSKKAVTKA CCCCCCCCHHHHHHH | 39.60 | - | |
| 16 | N6-crotonyl-L-lysine | PAPKKGSKKAVTKAQ CCCCCCCHHHHHHHH | 54.11 | - | |
| 16 | Acetylation | PAPKKGSKKAVTKAQ CCCCCCCHHHHHHHH | 54.11 | 16283522 | |
| 16 | Crotonylation | PAPKKGSKKAVTKAQ CCCCCCCHHHHHHHH | 54.11 | - | |
| 16 | Lactoylation | PAPKKGSKKAVTKAQ CCCCCCCHHHHHHHH | 54.11 | - | |
| 17 | Glutarylation | APKKGSKKAVTKAQK CCCCCCHHHHHHHHH | 50.19 | - | |
| 17 | Crotonylation | APKKGSKKAVTKAQK CCCCCCHHHHHHHHH | 50.19 | - | |
| 17 | Acetylation | APKKGSKKAVTKAQK CCCCCCHHHHHHHHH | 50.19 | 25786129 | |
| 17 | N6-crotonyl-L-lysine | APKKGSKKAVTKAQK CCCCCCHHHHHHHHH | 50.19 | - | |
| 17 | Lactoylation | APKKGSKKAVTKAQK CCCCCCHHHHHHHHH | 50.19 | - | |
| 21 | Lactoylation | GSKKAVTKAQKKDGK CCHHHHHHHHHHCCH | 42.07 | - | |
| 21 | Butyrylation | GSKKAVTKAQKKDGK CCHHHHHHHHHHCCH | 42.07 | - | |
| 21 | Other | GSKKAVTKAQKKDGK CCHHHHHHHHHHCCH | 42.07 | - | |
| 21 | Acetylation | GSKKAVTKAQKKDGK CCHHHHHHHHHHCCH | 42.07 | 16283522 | |
| 21 | N6-crotonyl-L-lysine | GSKKAVTKAQKKDGK CCHHHHHHHHHHCCH | 42.07 | - | |
| 21 | Crotonylation | GSKKAVTKAQKKDGK CCHHHHHHHHHHCCH | 42.07 | - | |
| 24 | Acetylation | KAVTKAQKKDGKERK HHHHHHHHHCCHHHH | 58.66 | 25786129 | |
| 24 | Lactoylation | KAVTKAQKKDGKERK HHHHHHHHHCCHHHH | 58.66 | - | |
| 24 | N6-crotonyl-L-lysine | KAVTKAQKKDGKERK HHHHHHHHHCCHHHH | 58.66 | - | |
| 24 | Crotonylation | KAVTKAQKKDGKERK HHHHHHHHHCCHHHH | 58.66 | - | |
| 24 | Other | KAVTKAQKKDGKERK HHHHHHHHHCCHHHH | 58.66 | - | |
| 25 | Other | AVTKAQKKDGKERKR HHHHHHHHCCHHHHH | 60.68 | - | |
| 25 | Acetylation | AVTKAQKKDGKERKR HHHHHHHHCCHHHHH | 60.68 | 26302492 | |
| 33 | Phosphorylation | DGKERKRSRKESYSV CCHHHHHHHHHHHHH | 51.22 | 23984901 | |
| 35 | Acetylation | KERKRSRKESYSVYV HHHHHHHHHHHHHHH | 52.86 | 72631205 | |
| 35 | N6-crotonyl-L-lysine | KERKRSRKESYSVYV HHHHHHHHHHHHHHH | 52.86 | - | |
| 35 | Glutarylation | KERKRSRKESYSVYV HHHHHHHHHHHHHHH | 52.86 | - | |
| 35 | Crotonylation | KERKRSRKESYSVYV HHHHHHHHHHHHHHH | 52.86 | - | |
| 35 | Succinylation | KERKRSRKESYSVYV HHHHHHHHHHHHHHH | 52.86 | 26843850 | |
| 35 | Other | KERKRSRKESYSVYV HHHHHHHHHHHHHHH | 52.86 | - | |
| 37 | Phosphorylation | RKRSRKESYSVYVYK HHHHHHHHHHHHHHH | 26.24 | 27097102 | |
| 38 | Phosphorylation | KRSRKESYSVYVYKV HHHHHHHHHHHHHHH | 11.84 | 27097102 | |
| 39 | Phosphorylation | RSRKESYSVYVYKVL HHHHHHHHHHHHHHH | 19.09 | 27097102 | |
| 41 | Phosphorylation | RKESYSVYVYKVLKQ HHHHHHHHHHHHHHH | 7.66 | 27097102 | |
| 43 | Phosphorylation | ESYSVYVYKVLKQVH HHHHHHHHHHHHHHC | 4.25 | - | |
| 44 | Glutarylation | SYSVYVYKVLKQVHP HHHHHHHHHHHHHCC | 30.92 | - | |
| 44 | Other | SYSVYVYKVLKQVHP HHHHHHHHHHHHHCC | 30.92 | - | |
| 44 | Lactoylation | SYSVYVYKVLKQVHP HHHHHHHHHHHHHCC | 30.92 | - | |
| 44 | Acetylation | SYSVYVYKVLKQVHP HHHHHHHHHHHHHCC | 30.92 | 25786129 | |
| 47 | Other | VYVYKVLKQVHPDTG HHHHHHHHHHCCCCC | 53.94 | - | |
| 47 | Glutarylation | VYVYKVLKQVHPDTG HHHHHHHHHHCCCCC | 53.94 | - | |
| 47 | Acetylation | VYVYKVLKQVHPDTG HHHHHHHHHHCCCCC | 53.94 | 25786129 | |
| 47 | Methylation | VYVYKVLKQVHPDTG HHHHHHHHHHCCCCC | 53.94 | - | |
| 47 | Ubiquitination | VYVYKVLKQVHPDTG HHHHHHHHHHCCCCC | 53.94 | - | |
| 53 | Phosphorylation | LKQVHPDTGISSKAM HHHHCCCCCCCHHHH | 40.65 | 22673903 | |
| 56 | Phosphorylation | VHPDTGISSKAMGIM HCCCCCCCHHHHHHH | 27.42 | 27097102 | |
| 57 | Phosphorylation | HPDTGISSKAMGIMN CCCCCCCHHHHHHHH | 23.63 | 27097102 | |
| 58 | "N6,N6-dimethyllysine" | PDTGISSKAMGIMNS CCCCCCHHHHHHHHH | 35.29 | - | |
| 58 | Methylation | PDTGISSKAMGIMNS CCCCCCHHHHHHHHH | 35.29 | - | |
| 58 | Other | PDTGISSKAMGIMNS CCCCCCHHHHHHHHH | 35.29 | - | |
| 65 | Phosphorylation | KAMGIMNSFVNDIFE HHHHHHHHHHHHHHH | 17.12 | 22108457 | |
| 79 | Methylation | ERIAGERRLAHYNKR HHHHCHHHHHHCCCC | 31.74 | - | |
| 85 | Other | RRLAHYNKRSTITSR HHHHHCCCCCCCCHH | 40.33 | - | |
| 85 | Lactoylation | RRLAHYNKRSTITSR HHHHHCCCCCCCCHH | 40.33 | - | |
| 85 | Methylation | RRLAHYNKRSTITSR HHHHHCCCCCCCCHH | 40.33 | - | |
| 85 | Acetylation | RRLAHYNKRSTITSR HHHHHCCCCCCCCHH | 40.33 | 25786129 | |
| 85 | "N6,N6,N6-trimethyllysine" | RRLAHYNKRSTITSR HHHHHCCCCCCCCHH | 40.33 | - | |
| 86 | Methylation | RLAHYNKRSTITSRE HHHHCCCCCCCCHHH | 35.08 | - | |
| 92 | Methylation | KRSTITSREIQTAVR CCCCCCHHHHHHHHH | 36.07 | - | |
| 108 | Glutarylation | LLPGELAKHAVSEGT HCCHHHHHHHHHHHH | 44.73 | - | |
| 108 | Lactoylation | LLPGELAKHAVSEGT HCCHHHHHHHHHHHH | 44.73 | - | |
| 108 | Other | LLPGELAKHAVSEGT HCCHHHHHHHHHHHH | 44.73 | - | |
| 108 | Ubiquitination | LLPGELAKHAVSEGT HCCHHHHHHHHHHHH | 44.73 | - | |
| 108 | Methylation | LLPGELAKHAVSEGT HCCHHHHHHHHHHHH | 44.73 | - | |
| 108 | Acetylation | LLPGELAKHAVSEGT HCCHHHHHHHHHHHH | 44.73 | 25786129 | |
| 112 | Phosphorylation | ELAKHAVSEGTKAVT HHHHHHHHHHHHHHH | 30.96 | 29779826 | |
| 112 | O-linked_Glycosylation | ELAKHAVSEGTKAVT HHHHHHHHHHHHHHH | 30.96 | - | |
| 115 | Phosphorylation | KHAVSEGTKAVTKYT HHHHHHHHHHHHHHC | 16.27 | 19346237 | |
| 116 | Other | HAVSEGTKAVTKYTS HHHHHHHHHHHHHCC | 52.28 | - | |
| 116 | Acetylation | HAVSEGTKAVTKYTS HHHHHHHHHHHHHCC | 52.28 | 22902405 | |
| 116 | Succinylation | HAVSEGTKAVTKYTS HHHHHHHHHHHHHCC | 52.28 | - | |
| 116 | Glutarylation | HAVSEGTKAVTKYTS HHHHHHHHHHHHHCC | 52.28 | - | |
| 116 | Lactoylation | HAVSEGTKAVTKYTS HHHHHHHHHHHHHCC | 52.28 | - | |
| 116 | Ubiquitination | HAVSEGTKAVTKYTS HHHHHHHHHHHHHCC | 52.28 | - | |
| 116 | Methylation | HAVSEGTKAVTKYTS HHHHHHHHHHHHHCC | 52.28 | - | |
| 119 | Phosphorylation | SEGTKAVTKYTSSK- HHHHHHHHHHCCCC- | 24.16 | 25575281 | |
| 120 | Other | EGTKAVTKYTSSK-- HHHHHHHHHCCCC-- | 39.67 | - | |
| 120 | Glutarylation | EGTKAVTKYTSSK-- HHHHHHHHHCCCC-- | 39.67 | - | |
| 120 | Lactoylation | EGTKAVTKYTSSK-- HHHHHHHHHCCCC-- | 39.67 | - | |
| 120 | Acetylation | EGTKAVTKYTSSK-- HHHHHHHHHCCCC-- | 39.67 | 25786129 | |
| 120 | Succinylation | EGTKAVTKYTSSK-- HHHHHHHHHCCCC-- | 39.67 | - | |
| 120 | Ubiquitination | EGTKAVTKYTSSK-- HHHHHHHHHCCCC-- | 39.67 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 15 | S | Phosphorylation | Kinase | MST1 | - | Uniprot |
| 37 | S | Phosphorylation | Kinase | AMPK | Q09137 | Uniprot |
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 4 | K | Methylation |
| - |
| 4 | K | Methylation |
| - |
| 4 | K | ubiquitylation |
| - |
| 4 | K | ubiquitylation |
| - |
| 15 | S | Phosphorylation |
| - |
| 15 | S | Phosphorylation |
| - |
| 35 | K | Methylation |
| - |
| 35 | K | ubiquitylation |
| - |
| 37 | S | Phosphorylation |
| - |
| 79 | K | Methylation |
| - |
| 79 | K | Methylation |
| - |
| 79 | K | ubiquitylation |
| - |
| 79 | K | ubiquitylation |
| - |
| 112 | S | ubiquitylation |
| - |
| 120 | K | ubiquitylation |
| - |
| 120 | K | ubiquitylation |
| - |
| 120 | K | Methylation |
| - |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H2B1_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of H2B1_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...