UniProt ID | H2B1C_MOUSE | |
---|---|---|
UniProt AC | Q6ZWY9 | |
Protein Name | Histone H2B type 1-C/E/G | |
Gene Name | Hist1h2bc | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 126 | |
Subcellular Localization | Nucleus. Chromosome. | |
Protein Description | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.. | |
Protein Sequence | MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MPEPAKSAP ------CCCCCCCCC | 57.17 | - | |
6 | N6-crotonyl-L-lysine | --MPEPAKSAPAPKK --CCCCCCCCCCCCC | 58.84 | - | |
6 | Acetylation | --MPEPAKSAPAPKK --CCCCCCCCCCCCC | 58.84 | 7608951 | |
6 | Butyrylation | --MPEPAKSAPAPKK --CCCCCCCCCCCCC | 58.84 | - | |
6 | Crotonylation | --MPEPAKSAPAPKK --CCCCCCCCCCCCC | 58.84 | 21925322 | |
6 | Lactoylation | --MPEPAKSAPAPKK --CCCCCCCCCCCCC | 58.84 | 31645732 | |
6 | Malonylation | --MPEPAKSAPAPKK --CCCCCCCCCCCCC | 58.84 | 26073543 | |
6 | Methylation | --MPEPAKSAPAPKK --CCCCCCCCCCCCC | 58.84 | - | |
6 | Other | --MPEPAKSAPAPKK --CCCCCCCCCCCCC | 58.84 | 27105115 | |
6 | Sumoylation | --MPEPAKSAPAPKK --CCCCCCCCCCCCC | 58.84 | 28289178 | |
6 | Ubiquitination | --MPEPAKSAPAPKK --CCCCCCCCCCCCC | 58.84 | - | |
7 | Phosphorylation | -MPEPAKSAPAPKKG -CCCCCCCCCCCCCC | 41.41 | 22817900 | |
12 | N6-crotonyl-L-lysine | AKSAPAPKKGSKKAV CCCCCCCCCCCHHHH | 72.39 | - | |
12 | Acetylation | AKSAPAPKKGSKKAV CCCCCCCCCCCHHHH | 72.39 | 90107 | |
12 | Crotonylation | AKSAPAPKKGSKKAV CCCCCCCCCCCHHHH | 72.39 | 21925322 | |
12 | Lactoylation | AKSAPAPKKGSKKAV CCCCCCCCCCCHHHH | 72.39 | 31645732 | |
12 | Other | AKSAPAPKKGSKKAV CCCCCCCCCCCHHHH | 72.39 | 27105115 | |
13 | N6-crotonyl-L-lysine | KSAPAPKKGSKKAVT CCCCCCCCCCHHHHH | 68.32 | - | |
13 | Acetylation | KSAPAPKKGSKKAVT CCCCCCCCCCHHHHH | 68.32 | 59955 | |
13 | Crotonylation | KSAPAPKKGSKKAVT CCCCCCCCCCHHHHH | 68.32 | 21925322 | |
13 | Other | KSAPAPKKGSKKAVT CCCCCCCCCCHHHHH | 68.32 | 24681537 | |
15 | Phosphorylation | APAPKKGSKKAVTKA CCCCCCCCHHHHHHH | 39.60 | 16039583 | |
16 | N6-crotonyl-L-lysine | PAPKKGSKKAVTKAQ CCCCCCCHHHHHHHH | 54.11 | - | |
16 | Acetylation | PAPKKGSKKAVTKAQ CCCCCCCHHHHHHHH | 54.11 | 59949 | |
16 | Crotonylation | PAPKKGSKKAVTKAQ CCCCCCCHHHHHHHH | 54.11 | 21925322 | |
16 | Lactoylation | PAPKKGSKKAVTKAQ CCCCCCCHHHHHHHH | 54.11 | 31645732 | |
17 | N6-crotonyl-L-lysine | APKKGSKKAVTKAQK CCCCCCHHHHHHHHH | 50.19 | - | |
17 | Acetylation | APKKGSKKAVTKAQK CCCCCCHHHHHHHHH | 50.19 | 90103 | |
17 | Crotonylation | APKKGSKKAVTKAQK CCCCCCHHHHHHHHH | 50.19 | 21925322 | |
17 | Glutarylation | APKKGSKKAVTKAQK CCCCCCHHHHHHHHH | 50.19 | - | |
17 | Lactoylation | APKKGSKKAVTKAQK CCCCCCHHHHHHHHH | 50.19 | 31645732 | |
21 | N6-crotonyl-L-lysine | GSKKAVTKAQKKDGK CCHHHHHHHHHHCCC | 42.07 | - | |
21 | Acetylation | GSKKAVTKAQKKDGK CCHHHHHHHHHHCCC | 42.07 | 59953 | |
21 | Butyrylation | GSKKAVTKAQKKDGK CCHHHHHHHHHHCCC | 42.07 | - | |
21 | Crotonylation | GSKKAVTKAQKKDGK CCHHHHHHHHHHCCC | 42.07 | 21925322 | |
21 | Lactoylation | GSKKAVTKAQKKDGK CCHHHHHHHHHHCCC | 42.07 | 31645732 | |
21 | Other | GSKKAVTKAQKKDGK CCHHHHHHHHHHCCC | 42.07 | 27105115 | |
21 | Sumoylation | GSKKAVTKAQKKDGK CCHHHHHHHHHHCCC | 42.07 | 28289178 | |
24 | N6-crotonyl-L-lysine | KAVTKAQKKDGKKRK HHHHHHHHHCCCCCC | 58.66 | - | |
24 | Acetylation | KAVTKAQKKDGKKRK HHHHHHHHHCCCCCC | 58.66 | 158387 | |
24 | Crotonylation | KAVTKAQKKDGKKRK HHHHHHHHHCCCCCC | 58.66 | 21925322 | |
24 | Lactoylation | KAVTKAQKKDGKKRK HHHHHHHHHCCCCCC | 58.66 | - | |
24 | Other | KAVTKAQKKDGKKRK HHHHHHHHHCCCCCC | 58.66 | 24681537 | |
25 | Acetylation | AVTKAQKKDGKKRKR HHHHHHHHCCCCCCC | 60.68 | 158511 | |
25 | Other | AVTKAQKKDGKKRKR HHHHHHHHCCCCCCC | 60.68 | 24681537 | |
33 | Phosphorylation | DGKKRKRSRKESYSV CCCCCCCCCHHHHHH | 51.22 | 21646345 | |
35 | N6-crotonyl-L-lysine | KKRKRSRKESYSVYV CCCCCCCHHHHHHHH | 52.86 | - | |
35 | Crotonylation | KKRKRSRKESYSVYV CCCCCCCHHHHHHHH | 52.86 | 21925322 | |
35 | Glutarylation | KKRKRSRKESYSVYV CCCCCCCHHHHHHHH | 52.86 | - | |
35 | Other | KKRKRSRKESYSVYV CCCCCCCHHHHHHHH | 52.86 | 27105115 | |
35 | Succinylation | KKRKRSRKESYSVYV CCCCCCCHHHHHHHH | 52.86 | - | |
35 | Ubiquitination | KKRKRSRKESYSVYV CCCCCCCHHHHHHHH | 52.86 | 27667366 | |
37 | Phosphorylation | RKRSRKESYSVYVYK CCCCCHHHHHHHHHH | 26.24 | 23684622 | |
38 | Phosphorylation | KRSRKESYSVYVYKV CCCCHHHHHHHHHHH | 11.84 | 25619855 | |
39 | Phosphorylation | RSRKESYSVYVYKVL CCCHHHHHHHHHHHH | 19.09 | 25521595 | |
41 | Phosphorylation | RKESYSVYVYKVLKQ CHHHHHHHHHHHHHH | 7.66 | 25619855 | |
43 | Phosphorylation | ESYSVYVYKVLKQVH HHHHHHHHHHHHHHC | 4.25 | 25619855 | |
44 | Acetylation | SYSVYVYKVLKQVHP HHHHHHHHHHHHHCC | 30.92 | 38024253 | |
44 | Glutarylation | SYSVYVYKVLKQVHP HHHHHHHHHHHHHCC | 30.92 | - | |
44 | Lactoylation | SYSVYVYKVLKQVHP HHHHHHHHHHHHHCC | 30.92 | - | |
44 | Other | SYSVYVYKVLKQVHP HHHHHHHHHHHHHCC | 30.92 | 24681537 | |
44 | Ubiquitination | SYSVYVYKVLKQVHP HHHHHHHHHHHHHCC | 30.92 | 27667366 | |
47 | Acetylation | VYVYKVLKQVHPDTG HHHHHHHHHHCCCCC | 53.94 | 22631111 | |
47 | Glutarylation | VYVYKVLKQVHPDTG HHHHHHHHHHCCCCC | 53.94 | - | |
47 | Methylation | VYVYKVLKQVHPDTG HHHHHHHHHHCCCCC | 53.94 | - | |
47 | Other | VYVYKVLKQVHPDTG HHHHHHHHHHCCCCC | 53.94 | 24681537 | |
47 | Ubiquitination | VYVYKVLKQVHPDTG HHHHHHHHHHCCCCC | 53.94 | 27667366 | |
53 | Phosphorylation | LKQVHPDTGISSKAM HHHHCCCCCCCHHHH | 40.65 | 23737553 | |
56 | Phosphorylation | VHPDTGISSKAMGIM HCCCCCCCHHHHHHH | 27.42 | 25521595 | |
57 | Phosphorylation | HPDTGISSKAMGIMN CCCCCCCHHHHHHHH | 23.63 | 25521595 | |
58 | "N6,N6-dimethyllysine" | PDTGISSKAMGIMNS CCCCCCHHHHHHHHH | 35.29 | - | |
58 | Methylation | PDTGISSKAMGIMNS CCCCCCHHHHHHHHH | 35.29 | - | |
58 | Other | PDTGISSKAMGIMNS CCCCCCHHHHHHHHH | 35.29 | 24681537 | |
58 | Ubiquitination | PDTGISSKAMGIMNS CCCCCCHHHHHHHHH | 35.29 | - | |
65 | Phosphorylation | KAMGIMNSFVNDIFE HHHHHHHHHHHHHHH | 17.12 | 21082442 | |
79 | Phosphorylation | ERIAGEASRLAHYNK HHHHHHHHHHHHHCC | 24.43 | 26643407 | |
80 | Methylation | RIAGEASRLAHYNKR HHHHHHHHHHHHCCC | 42.83 | - | |
84 | Phosphorylation | EASRLAHYNKRSTIT HHHHHHHHCCCCCCC | 19.44 | 22499769 | |
86 | "N6,N6,N6-trimethyllysine" | SRLAHYNKRSTITSR HHHHHHCCCCCCCHH | 40.33 | - | |
86 | Acetylation | SRLAHYNKRSTITSR HHHHHHCCCCCCCHH | 40.33 | 7610061 | |
86 | Lactoylation | SRLAHYNKRSTITSR HHHHHHCCCCCCCHH | 40.33 | 31645732 | |
86 | Methylation | SRLAHYNKRSTITSR HHHHHHCCCCCCCHH | 40.33 | - | |
86 | Other | SRLAHYNKRSTITSR HHHHHHCCCCCCCHH | 40.33 | 24681537 | |
86 | Ubiquitination | SRLAHYNKRSTITSR HHHHHHCCCCCCCHH | 40.33 | 27667366 | |
87 | Methylation | RLAHYNKRSTITSRE HHHHHCCCCCCCHHH | 35.08 | - | |
88 | Phosphorylation | LAHYNKRSTITSREI HHHHCCCCCCCHHHH | 26.27 | 26643407 | |
89 | Phosphorylation | AHYNKRSTITSREIQ HHHCCCCCCCHHHHH | 32.10 | 26643407 | |
91 | Phosphorylation | YNKRSTITSREIQTA HCCCCCCCHHHHHHH | 23.09 | 26643407 | |
92 | Phosphorylation | NKRSTITSREIQTAV CCCCCCCHHHHHHHH | 24.86 | 30352176 | |
93 | Methylation | KRSTITSREIQTAVR CCCCCCHHHHHHHHH | 36.07 | - | |
97 | Phosphorylation | ITSREIQTAVRLLLP CCHHHHHHHHHHHCC | 32.55 | 26745281 | |
109 | Acetylation | LLPGELAKHAVSEGT HCCHHHHHHHHHHHH | 44.73 | 163933 | |
109 | Glutarylation | LLPGELAKHAVSEGT HCCHHHHHHHHHHHH | 44.73 | - | |
109 | Lactoylation | LLPGELAKHAVSEGT HCCHHHHHHHHHHHH | 44.73 | 31645732 | |
109 | Malonylation | LLPGELAKHAVSEGT HCCHHHHHHHHHHHH | 44.73 | 26073543 | |
109 | Methylation | LLPGELAKHAVSEGT HCCHHHHHHHHHHHH | 44.73 | - | |
109 | Other | LLPGELAKHAVSEGT HCCHHHHHHHHHHHH | 44.73 | 27105115 | |
109 | Ubiquitination | LLPGELAKHAVSEGT HCCHHHHHHHHHHHH | 44.73 | 27667366 | |
113 | O-linked_Glycosylation | ELAKHAVSEGTKAVT HHHHHHHHHHHHHHH | 30.96 | - | |
113 | Phosphorylation | ELAKHAVSEGTKAVT HHHHHHHHHHHHHHH | 30.96 | 26824392 | |
116 | Phosphorylation | KHAVSEGTKAVTKYT HHHHHHHHHHHHHHC | 16.27 | 22817900 | |
117 | Glutarylation | HAVSEGTKAVTKYTS HHHHHHHHHHHHHCC | 52.28 | - | |
117 | Lactoylation | HAVSEGTKAVTKYTS HHHHHHHHHHHHHCC | 52.28 | 31645732 | |
117 | Malonylation | HAVSEGTKAVTKYTS HHHHHHHHHHHHHCC | 52.28 | 26073543 | |
117 | Methylation | HAVSEGTKAVTKYTS HHHHHHHHHHHHHCC | 52.28 | - | |
117 | Other | HAVSEGTKAVTKYTS HHHHHHHHHHHHHCC | 52.28 | 27105115 | |
117 | Succinylation | HAVSEGTKAVTKYTS HHHHHHHHHHHHHCC | 52.28 | - | |
117 | Ubiquitination | HAVSEGTKAVTKYTS HHHHHHHHHHHHHCC | 52.28 | 27667366 | |
120 | Phosphorylation | SEGTKAVTKYTSSK- HHHHHHHHHHCCCC- | 24.16 | 17488778 | |
121 | Acetylation | EGTKAVTKYTSSK-- HHHHHHHHHCCCC-- | 39.67 | 1919649 | |
121 | Glutarylation | EGTKAVTKYTSSK-- HHHHHHHHHCCCC-- | 39.67 | - | |
121 | Lactoylation | EGTKAVTKYTSSK-- HHHHHHHHHCCCC-- | 39.67 | - | |
121 | Other | EGTKAVTKYTSSK-- HHHHHHHHHCCCC-- | 39.67 | 24681537 | |
121 | Succinylation | EGTKAVTKYTSSK-- HHHHHHHHHCCCC-- | 39.67 | 22389435 | |
121 | Ubiquitination | EGTKAVTKYTSSK-- HHHHHHHHHCCCC-- | 39.67 | 27667366 | |
123 | Phosphorylation | TKAVTKYTSSK---- HHHHHHHCCCC---- | 28.25 | - | |
125 | Phosphorylation | AVTKYTSSK------ HHHHHCCCC------ | 34.29 | 29514104 | |
126 | Acetylation | VTKYTSSK------- HHHHCCCC------- | 65.21 | 7722269 |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
4 | K | Methylation |
| 24681537 |
4 | K | Methylation |
| 24681537 |
4 | K | ubiquitylation |
| 24681537 |
4 | K | ubiquitylation |
| 24681537 |
15 | S | Phosphorylation |
| 15197225 |
15 | S | Phosphorylation |
| 15197225 |
35 | K | Methylation |
| 21925322 |
35 | K | ubiquitylation |
| 21925322 |
37 | S | Phosphorylation |
| 20647423 |
79 | K | Methylation |
| - |
79 | K | Methylation |
| - |
79 | K | ubiquitylation |
| - |
79 | K | ubiquitylation |
| - |
113 | S | ubiquitylation |
| - |
121 | K | ubiquitylation |
| 22389435 |
121 | K | ubiquitylation |
| 22389435 |
121 | K | Methylation |
| 22389435 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H2B1C_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of H2B1C_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Substrate and functional diversity of lysine acetylation revealed bya proteomics survey."; Kim S.C., Sprung R., Chen Y., Xu Y., Ball H., Pei J., Cheng T.,Kho Y., Xiao H., Xiao L., Grishin N.V., White M., Yang X.-J., Zhao Y.; Mol. Cell 23:607-618(2006). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-12; LYS-13; LYS-16; LYS-17AND LYS-21, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"Signaling kinase AMPK activates stress-promoted transcription viahistone H2B phosphorylation."; Bungard D., Fuerth B.J., Zeng P.Y., Faubert B., Maas N.L., Viollet B.,Carling D., Thompson C.B., Jones R.G., Berger S.L.; Science 329:1201-1205(2010). Cited for: PHOSPHORYLATION AT SER-37. | |
"Histone modifications associated with somatic hypermutation."; Odegard V.H., Kim S.T., Anderson S.M., Shlomchik M.J., Schatz D.G.; Immunity 23:101-110(2005). Cited for: PHOSPHORYLATION AT SER-15. | |
"Phosphorylation of histone H2B at DNA double-strand breaks."; Fernandez-Capetillo O., Allis C.D., Nussenzweig A.; J. Exp. Med. 199:1671-1677(2004). Cited for: PHOSPHORYLATION AT SER-15. |