UniProt ID | H2B11_ARATH | |
---|---|---|
UniProt AC | P40283 | |
Protein Name | Histone H2B.11 | |
Gene Name | At5g59910 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 150 | |
Subcellular Localization | Nucleus. Chromosome. | |
Protein Description | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.. | |
Protein Sequence | MAPKAEKKPAEKKPASEKPVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | "N,N-dimethylalanine" | ------MAPKAEKKP ------CCCHHHCCC | 17.82 | - | |
2 | Methylation | ------MAPKAEKKP ------CCCHHHCCC | 17.82 | 17691833 | |
4 | Methylation | ----MAPKAEKKPAE ----CCCHHHCCCCC | 60.69 | 17691833 | |
7 | Acetylation | -MAPKAEKKPAEKKP -CCCHHHCCCCCCCC | 69.76 | 17691833 | |
12 | Acetylation | AEKKPAEKKPASEKP HHCCCCCCCCCCCCC | 67.19 | - | |
13 | "N6,N6-dimethyllysine" | EKKPAEKKPASEKPV HCCCCCCCCCCCCCH | 37.00 | - | |
13 | Methylation | EKKPAEKKPASEKPV HCCCCCCCCCCCCCH | 37.00 | - | |
28 | Acetylation | EEKSKAEKAPAEKKP HHHHHHHCCCHHHCC | 65.61 | - | |
33 | Acetylation | AEKAPAEKKPKAGKK HHCCCHHHCCCCCCC | 76.20 | - | |
39 | Acetylation | EKKPKAGKKLPKEAG HHCCCCCCCCCHHHC | 56.87 | 17691833 | |
40 | Acetylation | KKPKAGKKLPKEAGA HCCCCCCCCCHHHCC | 69.93 | 17691833 | |
81 | Phosphorylation | VHPDIGISSKAMGIM HCCCCCCCHHHHHHH | 22.15 | 25561503 | |
82 | Phosphorylation | HPDIGISSKAMGIMN CCCCCCCHHHHHHHH | 23.63 | 25561503 | |
116 | Phosphorylation | YNKKPTITSREIQTA HCCCCCCCHHHHHHH | 24.98 | 25561503 | |
117 | Phosphorylation | NKKPTITSREIQTAV CCCCCCCHHHHHHHH | 24.86 | 25561503 | |
138 | Phosphorylation | ELAKHAVSEGTKAVT HHHHHHHHHHCHHHH | 30.96 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of H2B11_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of H2B11_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H2B11_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of H2B11_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Characterization of post-translational modifications of histone H2B-variants isolated from Arabidopsis thaliana."; Bergmueller E., Gehrig P.M., Gruissem W.; J. Proteome Res. 6:3655-3668(2007). Cited for: ACETYLATION AT LYS-7; LYS-39 AND LYS-40, METHYLATION AT ALA-2, ANDMASS SPECTROMETRY. | |
Methylation | |
Reference | PubMed |
"Characterization of post-translational modifications of histone H2B-variants isolated from Arabidopsis thaliana."; Bergmueller E., Gehrig P.M., Gruissem W.; J. Proteome Res. 6:3655-3668(2007). Cited for: ACETYLATION AT LYS-7; LYS-39 AND LYS-40, METHYLATION AT ALA-2, ANDMASS SPECTROMETRY. |