UniProt ID | H2AZL_XENLA | |
---|---|---|
UniProt AC | P70094 | |
Protein Name | Histone H2A.Z-like | |
Gene Name | h2a.zl1 | |
Organism | Xenopus laevis (African clawed frog). | |
Sequence Length | 128 | |
Subcellular Localization | Nucleus. Chromosome. | |
Protein Description | Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be required at gastrulation for correct mesoderm formation.. | |
Protein Sequence | MAGGKAGKDTGKAKATSITRSSRAGLQFPVGRIHRLLKNRTTSHGRVGGTAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDALIKATIAGGGVIPHIHKSLIGKKGQQKTV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Acetylation | ---MAGGKAGKDTGK ---CCCCCCCCCCCC | 53.71 | - | |
8 | Acetylation | MAGGKAGKDTGKAKA CCCCCCCCCCCCCCC | 57.91 | - | |
12 | Acetylation | KAGKDTGKAKATSIT CCCCCCCCCCCCCCC | 49.13 | - | |
12 | Lactoylation | KAGKDTGKAKATSIT CCCCCCCCCCCCCCC | 49.13 | - | |
14 | Lactoylation | GKDTGKAKATSITRS CCCCCCCCCCCCCHH | 56.54 | - | |
116 | Lactoylation | GVIPHIHKSLIGKKG CCCHHHHHHHCCCCC | 46.48 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of H2AZL_XENLA !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of H2AZL_XENLA !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H2AZL_XENLA !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of H2AZL_XENLA !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...