dbPTM

H2AX_XENLA - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	H2AX_XENLA
UniProt AC	Q6GM86
Protein Name	Histone H2AX
Gene Name	h2afx
Organism	Xenopus laevis (African clawed frog).
Sequence Length	139
Subcellular Localization	Nucleus. Chromosome.
Protein Description	Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Required for checkpoint-mediated arrest of cell cycle progression in response to low doses of ionizing radiation and for efficient repair of DNA double strand breaks (DSBs) specifically when modified by C-terminal phosphorylation (By similarity)..
Protein Sequence	MSGRGKAVSKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKSRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKSSGGVSTSGKKSSQQSQEY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSGRGKAVS ------CCCCCCHHH	36.88	-
2	Phosphorylation	------MSGRGKAVS ------CCCCCCHHH	36.88	-
10	Lactoylation	GRGKAVSKTRAKAKT CCCCHHHHHHHHHHH	35.12	-
136	Phosphorylation	GKKSSQQSQEY---- CCCCCCCCCCC----	19.83	10477747
139	Phosphorylation	SSQQSQEY------- CCCCCCCC-------	19.06	19092802

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
139	Y	Phosphorylation	Kinase	WSTF	A8DZJ1	Uniprot
139	Y	Phosphorylation	Kinase	BAZ1B	-	GPS

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of H2AX_XENLA !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of H2AX_XENLA !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of H2AX_XENLA !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of H2AX_XENLA

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Megabase chromatin domains involved in DNA double-strand breaks invivo."; Rogakou E.P., Boon C., Redon C., Bonner W.M.; J. Cell Biol. 146:905-916(1999). Cited for: PHOSPHORYLATION AT SER-136.	10477747 [Abstract]
"WSTF regulates the H2A.X DNA damage response via a novel tyrosinekinase activity."; Xiao A., Li H., Shechter D., Ahn S.H., Fabrizio L.A.,Erdjument-Bromage H., Ishibe-Murakami S., Wang B., Tempst P.,Hofmann K., Patel D.J., Elledge S.J., Allis C.D.; Nature 457:57-62(2009). Cited for: PHOSPHORYLATION AT TYR-139.	19092802 [Abstract]