H2AB1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: H2AB1_HUMAN
• UniProt AC: P0C5Y9
• Protein Name: Histone H2A-Bbd type 1 {ECO:0000305}
• Gene Name: H2AFB1 {ECO:0000312|HGNC:HGNC:22516}
• Organism: Homo sapiens (Human).
• Sequence Length: 115
• Subcellular Localization: Nucleus . Chromosome . Associated with the active X chromosome and with autosomes, while it is absent from the inactive X chromosome and excluded from Barr bodies.
• Protein Description: Atypical histone H2A which can replace conventional H2A in some nucleosomes and is associated with active transcription and mRNA processing. [PubMed: 22795134 Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability]
• Protein Sequence: MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVPELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	RRRRRGSSGAGGRGR CCCCCCCCCCCCCCC	35.17	23911959
19	Phosphorylation	GAGGRGRTCSRTVRA CCCCCCCCCCCHHHH	20.05	23911959
29	Phosphorylation	RTVRAELSFSVSQVE CHHHHEEEECHHHHH	13.64	30622161
31	Phosphorylation	VRAELSFSVSQVERS HHHEEEECHHHHHHH	19.92	30622161
33	Phosphorylation	AELSFSVSQVERSLR HEEEECHHHHHHHHH	27.58	30622161
51	Phosphorylation	YAQRLSRTAPVYLAA HHHHHHCCHHHHHHH	31.75	-
55	Phosphorylation	LSRTAPVYLAAVIEY HHCCHHHHHHHHHHH	6.92	-
99	Phosphorylation	VHNDRLLSTLFNTTT HCCHHHHHHHCCCCC	27.88	30622161
100	Phosphorylation	HNDRLLSTLFNTTTI CCHHHHHHHCCCCCH	35.02	30622161
104	Phosphorylation	LLSTLFNTTTISQVA HHHHHCCCCCHHHCC	20.27	30622161
105	Phosphorylation	LSTLFNTTTISQVAP HHHHCCCCCHHHCCC	24.20	30622161
106	Phosphorylation	STLFNTTTISQVAPG HHHCCCCCHHHCCCC	19.32	30622161
108	Phosphorylation	LFNTTTISQVAPGED HCCCCCHHHCCCCCC	19.26	30622161

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of H2AB1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of H2AB1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of H2AB1_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of H2AB1_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.