H2A7_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: H2A7_ARATH
• UniProt AC: Q9FJE8
• Protein Name: Probable histone H2A.7
• Gene Name: At5g59870
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 150
• Subcellular Localization: Nucleus. Chromosome.
• Protein Description: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling..
• Protein Sequence: MESTGKVKKAFGGRKPPGAPKTKSVSKSMKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINSVLLPKKSATKPAEEKATKSPVKSPKKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
130	Phosphorylation	SVLLPKKSATKPAEE EEECCCCCCCCCHHH	47.50	27545962
132	Phosphorylation	LLPKKSATKPAEEKA ECCCCCCCCCHHHHH	44.65	25561503
140	Phosphorylation	KPAEEKATKSPVKSP CCHHHHHCCCCCCCC	43.02	23776212
142	Phosphorylation	AEEKATKSPVKSPKK HHHHHCCCCCCCCCC	30.48	23776212
145	Acetylation	KATKSPVKSPKKA-- HHCCCCCCCCCCC--	65.51	18030344
146	Phosphorylation	ATKSPVKSPKKA--- HCCCCCCCCCCC---	42.03	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of H2A7_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of H2A7_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of H2A7_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of H2A7_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks.";
Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.;
Plant Physiol. 150:889-903(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-146, AND MASSSPECTROMETRY.
PubMed: 19376835