| UniProt ID | H2A3_MOUSE | |
|---|---|---|
| UniProt AC | Q8BFU2 | |
| Protein Name | Histone H2A type 3 | |
| Gene Name | Hist3h2a | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 130 | |
| Subcellular Localization | Nucleus. Chromosome. | |
| Protein Description | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.. | |
| Protein Sequence | MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSGRGKQGG ------CCCCCCCCH | 36.88 | 7217105 | |
| 2 | Acetylation | ------MSGRGKQGG ------CCCCCCCCH | 36.88 | - | |
| 4 | Citrullination | ----MSGRGKQGGKA ----CCCCCCCCHHH | 41.66 | - | |
| 4 | Methylation | ----MSGRGKQGGKA ----CCCCCCCCHHH | 41.66 | 16699504 | |
| 4 | Citrullination | ----MSGRGKQGGKA ----CCCCCCCCHHH | 41.66 | - | |
| 6 | Acetylation | --MSGRGKQGGKARA --CCCCCCCCHHHHH | 44.39 | 24846263 | |
| 6 | Other | --MSGRGKQGGKARA --CCCCCCCCHHHHH | 44.39 | 27105115 | |
| 10 | Acetylation | GRGKQGGKARAKAKS CCCCCCHHHHHHHHH | 41.34 | 24846273 | |
| 10 | Other | GRGKQGGKARAKAKS CCCCCCHHHHHHHHH | 41.34 | 24681537 | |
| 10 | Lactoylation | GRGKQGGKARAKAKS CCCCCCHHHHHHHHH | 41.34 | - | |
| 10 | Succinylation | GRGKQGGKARAKAKS CCCCCCHHHHHHHHH | 41.34 | - | |
| 37 | N6-crotonyl-L-lysine | RVHRLLRKGNYSERV HHHHHHHCCCCHHCC | 52.02 | - | |
| 37 | Other | RVHRLLRKGNYSERV HHHHHHHCCCCHHCC | 52.02 | 27105115 | |
| 37 | Crotonylation | RVHRLLRKGNYSERV HHHHHHHCCCCHHCC | 52.02 | 21925322 | |
| 37 | Ubiquitination | RVHRLLRKGNYSERV HHHHHHHCCCCHHCC | 52.02 | - | |
| 41 | O-linked_Glycosylation | LLRKGNYSERVGAGA HHHCCCCHHCCCCCH | 23.95 | 27615797 | |
| 51 | Phosphorylation | VGAGAPVYLAAVLEY CCCCHHHHHHHHHHH | 6.92 | 26239621 | |
| 58 | Phosphorylation | YLAAVLEYLTAEILE HHHHHHHHHHHHHHH | 12.75 | 26239621 | |
| 75 | Other | GNAARDNKKTRIIPR CHHHHCCCCCCEEHH | 60.87 | 24681537 | |
| 76 | Other | NAARDNKKTRIIPRH HHHHCCCCCCEEHHH | 49.65 | 24681537 | |
| 96 | Glutarylation | RNDEELNKLLGRVTI CCHHHHHHHHCCEEE | 58.68 | - | |
| 96 | Other | RNDEELNKLLGRVTI CCHHHHHHHHCCEEE | 58.68 | 24681537 | |
| 96 | Succinylation | RNDEELNKLLGRVTI CCHHHHHHHHCCEEE | 58.68 | - | |
| 96 | Ubiquitination | RNDEELNKLLGRVTI CCHHHHHHHHCCEEE | 58.68 | - | |
| 96 | Acetylation | RNDEELNKLLGRVTI CCHHHHHHHHCCEEE | 58.68 | 37418441 | |
| 102 | Phosphorylation | NKLLGRVTIAQGGVL HHHHCCEEECCCCCC | 14.83 | 27180971 | |
| 105 | Methylation | LGRVTIAQGGVLPNI HCCEEECCCCCCCCE | 45.37 | 24352239 | |
| 119 | Crotonylation | IQAVLLPKKTESHHK EEEEECCCCCHHHHH | 72.76 | 21925322 | |
| 119 | Other | IQAVLLPKKTESHHK EEEEECCCCCHHHHH | 72.76 | 24681537 | |
| 119 | Ubiquitination | IQAVLLPKKTESHHK EEEEECCCCCHHHHH | 72.76 | - | |
| 119 | Glutarylation | IQAVLLPKKTESHHK EEEEECCCCCHHHHH | 72.76 | - | |
| 119 | N6-crotonyl-L-lysine | IQAVLLPKKTESHHK EEEEECCCCCHHHHH | 72.76 | - | |
| 119 | Acetylation | IQAVLLPKKTESHHK EEEEECCCCCHHHHH | 72.76 | 24469593 | |
| 120 | Crotonylation | QAVLLPKKTESHHKA EEEECCCCCHHHHHC | 56.43 | 15509584 | |
| 120 | Glutarylation | QAVLLPKKTESHHKA EEEECCCCCHHHHHC | 56.43 | - | |
| 120 | Other | QAVLLPKKTESHHKA EEEECCCCCHHHHHC | 56.43 | 27105115 | |
| 120 | Ubiquitination | QAVLLPKKTESHHKA EEEECCCCCHHHHHC | 56.43 | 15509584 | |
| 120 | N6-crotonyl-L-lysine | QAVLLPKKTESHHKA EEEECCCCCHHHHHC | 56.43 | - | |
| 120 | Acetylation | QAVLLPKKTESHHKA EEEECCCCCHHHHHC | 56.43 | 30589219 | |
| 121 | Phosphorylation | AVLLPKKTESHHKAK EEECCCCCHHHHHCC | 49.17 | 25266776 | |
| 123 | Phosphorylation | LLPKKTESHHKAKGK ECCCCCHHHHHCCCC | 35.80 | 25266776 | |
| 126 | Glutarylation | KKTESHHKAKGK--- CCCHHHHHCCCC--- | 46.50 | - | |
| 126 | Crotonylation | KKTESHHKAKGK--- CCCHHHHHCCCC--- | 46.50 | - | |
| 126 | Other | KKTESHHKAKGK--- CCCHHHHHCCCC--- | 46.50 | 27105115 | |
| 126 | N6-crotonyl-L-lysine | KKTESHHKAKGK--- CCCHHHHHCCCC--- | 46.50 | - | |
| 126 | Ubiquitination | KKTESHHKAKGK--- CCCHHHHHCCCC--- | 46.50 | - |
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 2 | S | Acetylation |
| - |
| 2 | S | Phosphorylation |
| - |
| 2 | S | Phosphorylation |
| - |
| 2 | S | Phosphorylation |
| - |
| 4 | R | Methylation |
| 16699504 |
| 14 | K | ubiquitylation |
| 15509584 |
| 14 | K | ubiquitylation |
| 15509584 |
| 16 | K | ubiquitylation |
| 15509584 |
| 16 | K | ubiquitylation |
| 15509584 |
| 27 | K | Methylation |
| 15509584 |
| 27 | K | ubiquitylation |
| 15509584 |
| 63 | K | ubiquitylation |
| 15509584 |
| 105 | Q | Methylation |
| 24352239 |
| 120 | K | ubiquitylation |
| 15525528 |
| 121 | T | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H2A3_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of H2A3_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Ubiquitylation | |
| Reference | PubMed |
| "Ring1b-mediated H2A ubiquitination associates with inactive Xchromosomes and is involved in initiation of X inactivation."; Fang J., Chen T., Chadwick B., Li E., Zhang Y.; J. Biol. Chem. 279:52812-52815(2004). Cited for: UBIQUITINATION AT LYS-120. | |
| "Polycomb group proteins Ring1A/B link ubiquitylation of histone H2Ato heritable gene silencing and X inactivation."; de Napoles M., Mermoud J.E., Wakao R., Tang Y.A., Endoh M.,Appanah R., Nesterova T.B., Silva J., Otte A.P., Vidal M., Koseki H.,Brockdorff N.; Dev. Cell 7:663-676(2004). Cited for: UBIQUITINATION AT LYS-120. | |