UniProt ID | H2A2_SCHPO | |
---|---|---|
UniProt AC | P04910 | |
Protein Name | Histone H2A-beta | |
Gene Name | hta2 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 131 | |
Subcellular Localization | Nucleus. Chromosome. | |
Protein Description | Core component of nucleosome which plays a central role in DNA double strand break (DSB) repair. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.. | |
Protein Sequence | MSGGKSGGKAAVAKSAQSRSAKAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGHVTIAQGGVVPNINAHLLPKQSGKGKPSQEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSGGKSGGK ------CCCCCCCHH | 57.14 | - | |
5 | Acetylation | ---MSGGKSGGKAAV ---CCCCCCCHHHHH | 49.83 | - | |
9 | Acetylation | SGGKSGGKAAVAKSA CCCCCCHHHHHHHHH | 36.38 | - | |
20 | Phosphorylation | AKSAQSRSAKAGLAF HHHHHHCHHHHCCCC | 39.09 | 25720772 | |
106 | Methylation | LGHVTIAQGGVVPNI HCCEEECCCCCCCCC | 45.37 | 24352239 | |
122 | Phosphorylation | AHLLPKQSGKGKPSQ EECCCCCCCCCCCCC | 48.90 | 29996109 | |
124 | Acetylation | LLPKQSGKGKPSQEL CCCCCCCCCCCCCCC | 69.84 | 21516229 | |
128 | Phosphorylation | QSGKGKPSQEL---- CCCCCCCCCCC---- | 39.51 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of H2A2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of H2A2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H2A2_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RNA1_SCHPO | rna1 | physical | 16540522 | |
RHP9_SCHPO | crb2 | physical | 20679488 | |
CND2_SCHPO | cnd2 | physical | 21633354 | |
H2B1_SCHPO | htb1 | physical | 27890612 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Histone H2A phosphorylation controls Crb2 recruitment at DNA breaks,maintains checkpoint arrest, and influences DNA repair in fissionyeast."; Nakamura T.M., Du L.-L., Redon C., Russell P.; Mol. Cell. Biol. 24:6215-6230(2004). Cited for: FUNCTION, MUTAGENESIS OF SER-128, AND PHOSPHORYLATION AT SER-128. |